From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001103000
  • symbol?:
  • description?: Uroporphyrin-III C-methyltransferase

      descriptions from strain specific annotations:

    • Uroporphyrin-III C-methyltransferase
    • conserved Prokaryal protein
  • strand?: -
  • coordinates?: 1382382..1382738
  • synteny block?: BlockID0006230
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0238
    08BA02176:
    C248_0223
    11819-97:
    MS7_0224
    71193:
    ST398NM01_0249
    ECT-R 2:
    ECTR2_198
    ED133:
    SAOV_0175
    ED98:
    SAAV_0203
    HO 5096 0412:
    SAEMRSA15_01970
    JH1:
    SaurJH1_0228
    JH9:
    SaurJH9_0222
    JKD6008:
    SAA6008_00208
    JKD6159:
    SAA6159_00215
    LGA251:
    SARLGA251_02020
    M013:
    M013TW_0217
    MRSA252:
    SAR0231
    MSHR1132:
    SAMSHR1132_02070
    MSSA476:
    SAS0214
    Mu3:
    SAHV_0237
    Mu50:
    SAV0238
    MW2:
    MW0214
    RF122:
    SAB0177c
    ST398:
    SAPIG0249
    T0131:
    SAT0131_00228
    TCH60:
    HMPREF0772_10266
    TW20:
    SATW20_02400
    USA300_TCH1516:
    USA300HOU_0247
    VC40:
    SAVC_00930

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTVDIGRIYDNKDNTDAIRILVDRVWPRGISKRTANLDYWLKDIAPSTELRQWFQHDPKL
    N315            MTVDIGRIYDNKDNTDAIRILVDRVWPRGISKRTANLDYWLKDIAPSTELRQWFQHDPKL
    NCTC8325        MTVDIGRIYDNKDNTDAIRILVDRVWPRGISKRTANLDYWLKDIAPSTELRQWFQHDPKL
    Newman          MTVDIGRIYDNKDNTDAIRILVDRVWPRGISKRTANLDYWLKDIAPSTELRQWFQHDPKL
    USA300_FPR3757  MTVDIGRIYDNKDNTDAIRILVDRVWPRGISKRTANLDYWLKDIAPSTELRQWFQHDPKL
                    ************************************************************

    COL             FGAFKEKYEKELRDQDAQKDAFEKLKDIVNQHNHVLLLYAAKDTKHNQAVVLQQLLNT
    N315            FGAFKEKYEKELRDQDAQKDAFEKLKDIVNQHNHVLLLYAAKDTKHNQAVVLQQLLNT
    NCTC8325        FGAFKEKYEKELRDQDAQKDAFEKLKDIVNQHNHVLLLYAAKDTKHNQAVVLQQLLNT
    Newman          FGAFKEKYEKELRDQDAQKDAFEKLKDIVNQHNHVLLLYAAKDTKHNQAVVLQQLLNT
    USA300_FPR3757  FGAFKEKYEKELRDQDAQKDAFEKLKDIVNQHNHVLLLYAAKDTKHNQAVVLQQLLNT
                    **********************************************************