From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0291 [new locus tag: SA_RS01690 ]
  • pan locus tag?: SAUPAN001221000
  • symbol: SA0291
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0291 [new locus tag: SA_RS01690 ]
  • symbol: SA0291
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 346338..346712
  • length: 375
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAAGAATATTGGTAGTATTTTTAATGTTAGCAATTATATTGGCAGGTTGTTCTAAT
    AAAGGTGAAAAGTATCAAAAAGATATTGATAAAGTGTACAAAGAACAGAATCAAATGAAT
    AAAATTGCCTCGAAAGTACAAAACACTATTAAAACAGACATTAAACAAGAAGACAGTAAT
    ACACATGTCTATAAAGATGGTAAAGTCATTGTTATTGGTATTCAATTATATAAAGATCGT
    GAAAAAATGTATTATTTCGCATATGAAATAAAAGATGGTAAGGCAGAGATTAATAGAGAA
    ATAGACCCAATTAAGTATATGAAAGACCATAAAGCAGATTATGAAGATGAAAATGTAGAA
    GTGGAAAAAGATTAA
    60
    120
    180
    240
    300
    360
    375

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0291 [new locus tag: SA_RS01690 ]
  • symbol: SA0291
  • description: hypothetical protein
  • length: 124
  • theoretical pI: 7.49053
  • theoretical MW: 14630.8
  • GRAVY: -0.770161

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cell structureCell envelopeSurface structurespilus (Caulobacter type) biogenesis lipoprotein CpaD (TIGR02522; HMM-score: 13.3)
    Genetic information processingMobile and extrachromosomal element functionsPlasmid functionsentry exclusion lipoprotein TrbK (TIGR04359; HMM-score: 12.6)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingouter membrane assembly lipoprotein YfgL (TIGR03300; HMM-score: 11.1)
    Unknown functionGeneralTIGR00374 family protein (TIGR00374; HMM-score: 10.8)
  • TheSEED:  
    FIG01108407: hypothetical protein 
  • PFAM:
    NTF2 (CL0051) DUF4467; Domain of unknown function with cystatin-like fold (DUF4467) (PF14729; HMM-score: 123)
    LppaM (CL0421) LPAM_1; Prokaryotic membrane lipoprotein lipid attachment site (PF08139; HMM-score: 17.3)
    no clan definedCag12; Cag pathogenicity island protein Cag12 (PF13117; HMM-score: 16.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: ILAGCSN
  • SignalP: Signal peptide length 25 aa
    • Ymax: 0.338
    • Ymax_pos: 25
    • Cmax: 0.182
    • Cmax_pos: 25
    • Smax: 0.851
    • Smax_pos: 6
    • Smean: 0.703
    • D: 0.48
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKRILVVFLMLAIILAGCSNKGEKYQKDIDKVYKEQNQMNKIASKVQNTIKTDIKQEDSNTHVYKDGKVIVIGIQLYKDREKMYYFAYEIKDGKAEINREIDPIKYMKDHKADYEDENVEVEKD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]