From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0299
  • pan locus tag?: SAUPAN001234000
  • symbol: SA0299
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0299
  • symbol: SA0299
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 354888..355649
  • length: 762
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAGCGATTCTGAGAAAGAAATTTTAAAAAGAATTAAAGATAATCCGTTTATTTCACAA
    CGTGAACTTGCTGAGGCAATTGGATTATCTAGACCCAGCGTAGCAAACATTATTTCAGGA
    TTAATACAAAAGGAATATGTTATGGGAAAGGCATATGTTTTAAATGAAGATTATCCTATT
    GTTTGTATTGGCGCAGCGAATGTAGATCGTAAGTTTTATGTGCATAAAGATTTAGTTGCA
    GAAACATCAAATCCTGTAACGTCAACACGCTCTATTGGTGGCGTAGCAAGAAATATTGCT
    GAGAACTTAGGTAGGCTTGGCGAAACGGTCGCTTTTTTATCTGCTAGTGGACAAGATAGT
    GAATGGGAAATGATTAAACGATTGTCCACACCATTTATGAATTTGGATCATGTTCAACAA
    TTTGAAAATGCGAGTACAGGTTCATATACAGCTTTAATTAGTAAAGAAGGCGACATGACA
    TATGGCTTAGCAGATATGGAAGTGTTTGACTACATTACGCCTGAATTTTTAATTAAGCGT
    TCACACTTATTGAAAAAGGCTAAGTGCATTATTGTCGATTTGAATTTAGGCAAAGAGGCA
    TTAAACTTCTTATGTGCCTATACCACGAAACATCAAATCAAATTAGTTATCACCACGGTT
    TCTTCCCCAAAAATGAAAAATATGCCTGATTCATTACATGCTATTGATTGGATTATCACG
    AATAAAGATGAAACAGAAACATACTTAAATTTAAAAATATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    762

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0299
  • symbol: SA0299
  • description: hypothetical protein
  • length: 253
  • theoretical pI: 6.36565
  • theoretical MW: 28314.4
  • GRAVY: -0.158103

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismSugarsribokinase (TIGR02152; EC 2.7.1.15; HMM-score: 45.2)
    EPS-associated transcriptional regulator, MarR family (TIGR04176; HMM-score: 26.3)
    MetabolismEnergy metabolismSugars5-dehydro-2-deoxygluconokinase (TIGR04382; EC 2.7.1.92; HMM-score: 19.5)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesbifunctional protein RfaE, domain I (TIGR02198; EC 2.7.1.-; HMM-score: 18.9)
    Signal transductionRegulatory functionsDNA interactionsCRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 14.4)
    ParB/RepB/Spo0J family partition protein (TIGR00180; HMM-score: 12.3)
    Signal transductionRegulatory functionsDNA interactionsTyrR family helix-turn-helix domain (TIGR04381; HMM-score: 12)
  • TheSEED:  
    Nucleosides and NucleotidesNucleosides and Nucleotides - no subcategoryPseudouridine Metabolism Pseudouridine kinase (EC 2.7.1.83) 
    CBSS-176299.3.peg.235 Pseudouridine kinase (EC 2.7.1.83) 
  • PFAM:
    Ribokinase (CL0118) PfkB; pfkB family carbohydrate kinase (PF00294; HMM-score: 71.1)
    HTH (CL0123) HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 40.4)
    MarR; MarR family (PF01047; HMM-score: 27.8)
    HTH_AsnC-type; AsnC-type helix-turn-helix domain (PF13404; HMM-score: 21.4)
    MarR_2; MarR family (PF12802; HMM-score: 20.7)
    HTH_3; Helix-turn-helix (PF01381; HMM-score: 20.6)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 18.6)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 18.6)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 18)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 16.9)
    Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 16.2)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 15.9)
    HTH_11; HTH domain (PF08279; HMM-score: 15.8)
    YdaS_antitoxin; Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT (PF15943; HMM-score: 14.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.119
    • Ymax_pos: 52
    • Cmax: 0.118
    • Cmax_pos: 38
    • Smax: 0.18
    • Smax_pos: 1
    • Smean: 0.096
    • D: 0.11
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSDSEKEILKRIKDNPFISQRELAEAIGLSRPSVANIISGLIQKEYVMGKAYVLNEDYPIVCIGAANVDRKFYVHKDLVAETSNPVTSTRSIGGVARNIAENLGRLGETVAFLSASGQDSEWEMIKRLSTPFMNLDHVQQFENASTGSYTALISKEGDMTYGLADMEVFDYITPEFLIKRSHLLKKAKCIIVDLNLGKEALNFLCAYTTKHQIKLVITTVSSPKMKNMPDSLHAIDWIITNKDETETYLNLKI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CcpA
    CcpA (TF) important in Carbon catabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]