From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001234000
  • symbol?:
  • description?: carbohydrate kinase

      descriptions from strain specific annotations:

    • carbohydrate kinase
    • PfkB family carbohydrate kinase
    • carbohydrate kinase, PfkB family
    • carbohydrate kinase-like protein
    • marR family protein
    • pfkB family carbohydrate kinase family protein
    • Pseudouridine kinase
    • ribokinase-like domain-containing protein
    • sugar kinase in cluster with indigoidine synthase indA , PfkB family of kinases
  • strand?: +
  • coordinates?: 1519123..1519899
  • synteny block?: BlockID0007450
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0310
    08BA02176:
    C248_0300
    11819-97:
    MS7_0301
    71193:
    ST398NM01_0324
    ECT-R 2:
    ECTR2_271
    ED133:
    SAOV_0264
    ED98:
    SAAV_0278
    HO 5096 0412:
    SAEMRSA15_02670
    JH1:
    SaurJH1_0301
    JH9:
    SaurJH9_0294
    JKD6008:
    SAA6008_00287
    JKD6159:
    SAA6159_00287
    LGA251:
    SARLGA251_02730
    M013:
    M013TW_0292
    MRSA252:
    SAR0308
    MSHR1132:
    SAMSHR1132_02850
    MSSA476:
    SAS0288
    Mu3:
    SAHV_0308
    Mu50:
    SAV0311
    MW2:
    MW0288
    RF122:
    SAB0248
    ST398:
    SAPIG0324
    T0131:
    SAT0131_00315
    TCH60:
    HMPREF0772_10184
    TW20:
    SATW20_03160
    USA300_TCH1516:
    USA300HOU_0331
    VC40:
    SAVC_01305

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSDSEKEILKRIKDNPFISQRELAEAIGLSRPSVANIISGLIQKEYVMGKAYVLNEDYPI
    N315            MSDSEKEILKRIKDNPFISQRELAEAIGLSRPSVANIISGLIQKEYVMGKAYVLNEDYPI
    NCTC8325        MSDSEKEILKRIKDNPFISQRELAEAIGLSRPSVANIISGLIQKEYVMGKAYVLNEDYPI
    Newman          MSDSEKEILKRIKDNPFISQRELAEAIGLSRPSVANIISGLIQKEYVMGKAYVLNEDYPI
    USA300_FPR3757  MSDSEKEILKRIKDNPFISQRELAEAIGLSRPSVANIISGLIQKEYVMGKAYVLNEDYPI
                    ************************************************************

    COL             VCIGAANVDRKFYVHKNLVAETSNPVTSTRSIGGVARNIAENLGRLGETVAFLSASGQDS
    N315            VCIGAANVDRKFYVHKDLVAETSNPVTSTRSIGGVARNIAENLGRLGETVAFLSASGQDS
    NCTC8325        VCIGAANVDRKFYVHKNLVAETSNPVTSTRSIGGVARNIAENLGRLGETVAFLSASGQDS
    Newman          VCIGAANVDRKFYVHKNLVAETSNPVTSTRSIGGVARNIAENLGRLGETVAFLSASGQDS
    USA300_FPR3757  VCIGAANVDRKFYVHKNLVAETSNPVTSTRSIGGVARNIAENLGRLGETVAFLSASGQDS
                    ****************:*******************************************

    COL             EWEMIKRLSTPFMNLDHVQQFENASTGSYTALISKEGDMTYGLADMEVFDYITPEFLIKR
    N315            EWEMIKRLSTPFMNLDHVQQFENASTGSYTALISKEGDMTYGLADMEVFDYITPEFLIKR
    NCTC8325        EWEMIKRLSTPFMNLDHVQQFENASTGSYTALISKEGDMTYGLADMEVFDYITPEFLIKR
    Newman          EWEMIKRLSTPFMNLDHVQQFENASTGSYTALISKEGDMTYGLADMEVFDYITPEFLIKR
    USA300_FPR3757  EWEMIKRLSTPFMNLDHVQQFENASTGSYTALISKEGDMTYGLADMEVFDYITPEFLIKR
                    ************************************************************

    COL             SHLLKKAKCIIVDLNLGKEALNFLCAYTTKHQIKLVITTVSSPKMKNMPDSLHAIDWIIT
    N315            SHLLKKAKCIIVDLNLGKEALNFLCAYTTKHQIKLVITTVSSPKMKNMPDSLHAIDWIIT
    NCTC8325        SHLLKKAKCIIVDLNLGKEALNFLCAYTTKHQIKLVITTVSSPKMKNMPDSLHAIDWIIT
    Newman          SHLLKKAKCIIVDLNLGKEALNFLCAYTTKHQIKLVITTVSSPKMKNMPDSLHAIDWIIT
    USA300_FPR3757  SHLLKKAKCIIVDLNLGKEALNFLCAYTTKHQIKLVITTVSSPKMKNMPDSLHAIDWIIT
                    ************************************************************

    COL             NKDETETYLNLKIESTDDLKIAAKRWNDLGVKNVIVTNGVKELIYRSGEEEIIKSVMPSN
    N315            NKDETETYLNLKI-----------------------------------------------
    NCTC8325        NKDETETYLNLKIESTDDLKIAAKRWNDLGVKNVIVTNGVKELIYRSGEEEIIKSVMPSN
    Newman          NKDETETYLNLKIESTDDLKIAAKRWNDLGVKNVIVTNGVKELIYRSGEEEIIKSVMPSN
    USA300_FPR3757  NKDETETYLNLKIESTDDLKIAAKRWNDLGVKNVIVTNGVKELIYRSGEEEIIKSVMPSN
                    *************                                               

    COL             SVKDVTGAGDSFCAAVVYSWLNGMSTEDILIAGMVNAKKTIETKYTVRQNLDQQQLYHDM
    N315            ------------------------------------------------------------
    NCTC8325        SVKDVTGAGDSFCAAVVYSWLNGMSTEDILIAGMVNAKKTIETKYTVRQNLDQQQLYHDM
    Newman          SVKDVTGAGDSFCAAVVYSWLNGMSTEDILIAGMVNAKKTIETKYTVRQNLDQQQLYHDM
    USA300_FPR3757  SVKDVTGAGDSFCAAVVYSWLNGMSTEDILIAGMVNAKKTIETKYTVRQNLDQQQLYHDM
                                                                                

    COL             EDYKNGKFTKVY
    N315            ------------
    NCTC8325        EDYKNGKFTKVY
    Newman          EDYKNGKFTKVY
    USA300_FPR3757  EDYKNGKFTKVY