From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0337 [new locus tag: SA_RS01930 ]
  • pan locus tag?: SAUPAN001892000
  • symbol: SA0337
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0337 [new locus tag: SA_RS01930 ]
  • symbol: SA0337
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 394648..394851
  • length: 204
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    GTGCGTAATCGATTGAAAGAGTTACGAGCACGAGATGGCTTAAATCAAACGCAGCTTGCC
    AAACTAGCTGGTGTTTCAAGACAAACCATTTCGCTAATTGAGCGAAACAATTTTATGCCA
    TCAGTATTAACGGCAATAAAGATTGCTCGCATTTTCAATGAAACGGTGGAAACGGTTTTT
    ATTATTGAGGAGGATGAAGCATGA
    60
    120
    180
    204

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0337 [new locus tag: SA_RS01930 ]
  • symbol: SA0337
  • description: hypothetical protein
  • length: 67
  • theoretical pI: 9.43033
  • theoretical MW: 7673.83
  • GRAVY: -0.195522

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator, y4mF family (TIGR03070; HMM-score: 34.9)
    Signal transductionRegulatory functionsDNA interactionsDNA-binding protein, Tfx family (TIGR00721; HMM-score: 20.5)
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 20.5)
    Genetic information processingMobile and extrachromosomal element functionsOtheraddiction module antidote protein, HigA family (TIGR02607; HMM-score: 20.3)
    Signal transductionRegulatory functionsDNA interactionsaddiction module antidote protein, HigA family (TIGR02607; HMM-score: 20.3)
    Signal transductionRegulatory functionsProtein interactionsaddiction module antidote protein, HigA family (TIGR02607; HMM-score: 20.3)
    Unknown functionGeneralmobile mystery protein A (TIGR02612; HMM-score: 15.8)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 13.5)
  • TheSEED:  
    Transcriptional regulator, XRE family 
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 57)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 44.7)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 36.1)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 25.5)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 21.5)
    HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 21)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 19.3)
    LacI; Bacterial regulatory proteins, lacI family (PF00356; HMM-score: 19.3)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 18.7)
    MarR_2; MarR family (PF12802; HMM-score: 17.5)
    Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 17.1)
    HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 16.8)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 16.5)
    MarR; MarR family (PF01047; HMM-score: 15.8)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 15.8)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 15.3)
    HTH_11; HTH domain (PF08279; HMM-score: 14.3)
    HTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.6)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 13.6)
    no clan definedTnsD; Tn7-like transposition protein D (PF15978; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.157
    • Ymax_pos: 12
    • Cmax: 0.113
    • Cmax_pos: 23
    • Smax: 0.313
    • Smax_pos: 1
    • Smean: 0.228
    • D: 0.185
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRNRLKELRARDGLNQTQLAKLAGVSRQTISLIERNNFMPSVLTAIKIARIFNETVETVFIIEEDEA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]