From AureoWiki
Jump to: navigation, search

NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0367 [new locus tag: SA_RS02100 ]
  • pan locus tag?: SAUPAN001984000
  • symbol: SA0367
  • pan gene symbol?: nfrA
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0367 [new locus tag: SA_RS02100 ]
  • symbol: SA0367
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 423610..424365
  • length: 756
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    GTGTCAGATTATGTATATAATCTTGTGAAAAAGCATCATTCTGTTAGAAAATTTAAGAAT
    AAACCTTTAAGTGAAGACGTTGTTAAGAAATTGGTAGAAGCTGGACAAAGCGCTTCGACG
    TCAAGTTTCCTACAAGCATACTCAATTATTGGTATCGACGATGAGAAGATTAAAGAAAAT
    TTACGAGAAGTTTCTGGACAACCTTATGTTGTAGAAAATGGCTATTTATTCGTCTTTGTT
    ATTGATTATTATCGTCATCATTTAGTTGATCAACATGCTGAAACTGATATGGAAAATGCA
    TATGGTTCAACGGAAGGTTTGCTAGTAGGTGCAATCGATGCAGCATTAGTTGCTGAAAAT
    ATTGCGGTAACTGCTGAAGATATGGGGTATGGCATTGTCTTTTTAGGATCATTAAGAAAT
    GATGTTGAACGAGTTCGAGAAATTTTAGACTTACCTGACTATGTCTTCCCGGTATTTGGT
    ATGGCAGTAGGGGAACCCGCAGATGATGAAAATGGTGCAGCCAAGCCACGCTTACCATTT
    GACCATGTCTTCCATCATAATAAGTATCATGCTGATAAGGAAACACAGTATGCACAAATG
    GCAGATTACGACCAGACAATCAGCGAGTACTATGATCAACGTACAAACGGGAATCGCAAA
    GAAACATGGTCGCAGCAAATTGAGATGTTCCTAGGAAACAAAGCAAGATTAGATATGTTA
    GAACAATTGCAAAAATCAGGCTTAATACAGCGATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    756

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0367 [new locus tag: SA_RS02100 ]
  • symbol: SA0367
  • description: hypothetical protein
  • length: 251
  • theoretical pI: 4.83998
  • theoretical MW: 28608.8
  • GRAVY: -0.482869

Function[edit source | edit]

  • reaction:
    EC 1.6.-.-?  ExPASy
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalamin5,6-dimethylbenzimidazole synthase (TIGR02476; EC 1.14.99.40; HMM-score: 31.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherF420 biosynthesis protein FbiB, C-terminal domain (TIGR03553; HMM-score: 27.4)
    and 1 more
    SagB-type dehydrogenase domain (TIGR03605; HMM-score: 12.8)
  • TheSEED:  
    FMN reductase (NADPH) (EC 1.5.1.38) 
  • PFAM:
    FMN-dep-NRtase (CL0529) Nitroreductase; Nitroreductase family (PF00881; HMM-score: 66.2)
    and 1 more
    TM1586_NiRdase; Putative TM nitroreductase (PF14512; HMM-score: 18.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: FMN
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.176
    • Ymax_pos: 17
    • Cmax: 0.111
    • Cmax_pos: 47
    • Smax: 0.4
    • Smax_pos: 6
    • Smean: 0.288
    • D: 0.22
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSDYVYNLVKKHHSVRKFKNKPLSEDVVKKLVEAGQSASTSSFLQAYSIIGIDDEKIKENLREVSGQPYVVENGYLFVFVIDYYRHHLVDQHAETDMENAYGSTEGLLVGAIDAALVAENIAVTAEDMGYGIVFLGSLRNDVERVREILDLPDYVFPVFGMAVGEPADDENGAAKPRLPFDHVFHHNKYHADKETQYAQMADYDQTISEYYDQRTNGNRKETWSQQIEMFLGNKARLDMLEQLQKSGLIQR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA0367 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY regulon
    CodY(TF)important in Amino acid metabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]