From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0386 [new locus tag: SA_RS02210 ]
  • pan locus tag?: SAUPAN002110000
  • symbol: set10
  • pan gene symbol?: ssl5
  • synonym:
  • product: superantigen-like protein 5

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0386 [new locus tag: SA_RS02210 ]
  • symbol: set10
  • product: superantigen-like protein 5
  • replicon: chromosome
  • strand: +
  • coordinates: 445730..446434
  • length: 705
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAAATGGCAGCAATTGCGAAAGCAAGTTTAGCATTAGGTATTTTAGCAACAGGAACA
    ATAACGTCATTGCATCAAACTGTAAATGCGAGTGAACATGAAGCAAAATATGAAAATGTG
    ACAAAAGATATCTTTGACTTAAGAGATTACTATAGTGGCGCAAGTAAGGAACTTAAAAAT
    GTTACTGGTTATCGTTATAGCAAAGGTGGCAAGCATTACCTTATCTTTGATAAAAATAGA
    AAATTCACAAGAGTACAGATATTTGGTAAAGATATTGAAAGATTTAAAGCACGCAAAAAT
    CCGGGATTAGACATATTTGTTGTTAAAGAAGCAGAAAATCGCAACGGCACAGTGTTTTCA
    TATGGTGGTGTCACTAAGAAAAATCAAGACGCTTATTATGATTATATAAACGCACCAAGA
    TTTCAAATCAAGAGAGATGAAGGTGACGGTATTGCTACGTACGGTAGAGTACACTACATT
    TATAAAGAAGAGATTTCACTTAAAGAACTCGACTTTAAATTGAGACAGTATTTAATTCAA
    AATTTTGATCTGTATAAAAAGTTTCCTAAAGATAGTAAGATAAAAGTGATAATGAAAGAT
    GGCGGCTATTATACGTTTGAACTTAATAAAAAATTACAAACAAATCGCATGAGTGATGTC
    ATTGACGGTAGAAATATTGAAAAAATAGAAGCCAACATTAGATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    705

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0386 [new locus tag: SA_RS02210 ]
  • symbol: Set10
  • description: superantigen-like protein 5
  • length: 234
  • theoretical pI: 10.028
  • theoretical MW: 27140.8
  • GRAVY: -0.667094

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Exotoxin 10 
  • PFAM:
    OB_enterotoxin (CL0658) SSL_OB; Staphylococcal superantigen-like OB-fold domain (PF09199; HMM-score: 106.3)
    Ant-toxin_C (CL0386) Stap_Strp_tox_C; Staphylococcal/Streptococcal toxin, beta-grasp domain (PF02876; HMM-score: 25)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 10
    • Internal Helices: 0
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: -0.17
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide length 31 aa
    • Ymax: 0.774
    • Ymax_pos: 31
    • Cmax: 0.749
    • Cmax_pos: 31
    • Smax: 0.889
    • Smax_pos: 16
    • Smean: 0.823
    • D: 0.793
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 15926103 NCBI
  • RefSeq: NP_373636 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MKMAAIAKASLALGILATGTITSLHQTVNASEHEAKYENVTKDIFDLRDYYSGASKELKNVTGYRYSKGGKHYLIFDKNRKFTRVQIFGKDIERFKARKNPGLDIFVVKEAENRNGTVFSYGGVTKKNQDAYYDYINAPRFQIKRDEGDGIATYGRVHYIYKEEISLKELDFKLRQYLIQNFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQTNRMSDVIDGRNIEKIEANIR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Stefan Monecke, Peter Slickers, Ralf Ehricht
Assignment of Staphylococcus aureus isolates to clonal complexes based on microarray analysis and pattern recognition.
FEMS Immunol. Med. Microbiol.: 2008, 53(2);237-51
[PubMed:18507678] [WorldCat.org] [DOI] (P p)