From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002110000
  • symbol?: ssl5
  • description?: staphylococcal superantigen-like protein 5

      descriptions from strain specific annotations:

    • staphylococcal superantigen-like protein 5
    • superantigen-like protein 5
    • Staphylococcal exotoxin
    • Exotoxin 10
    • exotoxin 3
  • strand?: +
  • coordinates?: 2595688..2597821
  • synteny block?: BlockID0014160
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0386 (set10)
    NCTC8325:
    Newman:
    NWMN_0392 (set5nm)
    USA300_FPR3757:
    04-02981:
    SA2981_0401 (set10)
    08BA02176:
    C248_0477 (set3)
    11819-97:
    MS7_0401 (set3)
    71193:
    ST398NM01_0495
    ECT-R 2:
    ECTR2_361
    ED133:
    SAOV_0445
    ED98:
    SAAV_0369
    HO 5096 0412:
    SAEMRSA15_03570 (set3)
    JH1:
    SaurJH1_0461
    JH9:
    SaurJH9_0449
    JKD6008:
    SAA6008_00427 (set10)
    JKD6159:
    LGA251:
    SARLGA251_03640 (set3)
    M013:
    M013TW_0387
    MRSA252:
    SAR0427 (set3)
    MSHR1132:
    SAMSHR1132_03750
    MSSA476:
    SAS0388
    Mu3:
    SAHV_0423 (set10)
    Mu50:
    SAV0425 (set10)
    MW2:
    MW0386 (set20)
    RF122:
    SAB0379 (set7)
    ST398:
    SAPIG0495
    T0131:
    SAT0131_00464
    TCH60:
    HMPREF0772_10090 (set3)
    TW20:
    SATW20_05010 (set3)
    USA300_TCH1516:
    USA300HOU_0427 (set20)
    VC40:
    SAVC_01755

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MKMAAIAKASLALGILATGTITSLHQTVNASEHEAKYENVTKDIFDLRDYYSGASKELKN
    NCTC8325        MKMTAIAKASLALGILATGTITSLHQTVNASEHKAKYENVTKDIFDLRDYYSGASKELKN
    Newman          MKMTAIAKASLALGILATGTITSLHQTVNASEHKAKYENVTKDIFDLRDYYSGASKELKN
    USA300_FPR3757  MKMTAIAKASLALGILATGTITSLHQTVNASEHKAKYENVTKDIFDLRDYYSGASKELKN
                    ***:*****************************:**************************

    N315            VTGYRYSKGGKHYLIFDKNRKFTRVQIFGKDIERFKARKNPGLDIFVVKEAENRNGTVFS
    NCTC8325        VTGYRYSKGGKHYLIFDKNRKFTRVQIFGKDIERFKARKNPGLDIFVVKEAENRNGTVFS
    Newman          VTGYRYSKGGKHYLIFDKNRKFTRVQIFGKDIERFKARKNPGLDIFVVKEAENRNGTVFS
    USA300_FPR3757  VTGYRYSKGGKHYLIFDKNRKFTRVQIFGKDIERFKARKNPGLDIFVVKEAENRNGTVFS
                    ************************************************************

    N315            YGGVTKKNQDAYYDYINAPRFQIKRDEGDGIATYGRVHYIYKEEISLKELDFKLRQYLIQ
    NCTC8325        YGGVTKKNQDAYYDYINAPRFQIKRDEGDGIATYGRVHYIYKEEISLKELDFKLRQYLIQ
    Newman          YGGVTKKNQDAYYDYINAPRFQIKRDEGDGIATYGRVHYIYKEEISLKELDFKLRQYLIQ
    USA300_FPR3757  YGGVTKKNQDAYYDYINAPRFQIKRDEGDGIATYGRVHYIYKEEISLKELDFKLRQYLIQ
                    ************************************************************

    N315            NFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQTNRMSDVIDGRNIEKIEANIR
    NCTC8325        NFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQTNRMSDVIDGRNIEKIEANIR
    Newman          NFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQTNRMSDVIDGRNIEKIEANIR
    USA300_FPR3757  NFDLYKKFPKDSKIKVIMKDGGYYTFELNKKLQTNRMSDVIDGRNIEKIEANIR
                    ******************************************************