From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0444 [new locus tag: SA_RS02560 ]
  • pan locus tag?: SAUPAN002221000
  • symbol: SA0444
  • pan gene symbol?:
  • synonym:
  • product: DNA replication intiation control protein YabA

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0444 [new locus tag: SA_RS02560 ]
  • symbol: SA0444
  • product: DNA replication intiation control protein YabA
  • replicon: chromosome
  • strand: +
  • coordinates: 516454..516822
  • length: 369
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATTAAGGAGGCATTATTACATTTGGATCGCAATGAAATATTTGAAAAAATAATGCGTTTA
    GAAATGAATGTCAATCAACTTTCAAAGGAAACTTCAGAATTAAAGGCACATGCAGTTGAA
    TTAGTAGAAGAAAATGTAGCGCTTCAACTTGAAAATGATAATTTGAAAAAGGTGTTGGGC
    AATGATGAACCAACTACTATTGATACTGCGAATTCAAAACCAGCAAAAGCTGTGAAAAAG
    CCATTACCAAGTAAAGATAATTTGGCTATATTGTATGGAGAAGGATTTCATATTTGTAAA
    GGCGAATTATTTGGAAAACATCGACATGGTGAAGATTGTCTGTTCTGTTTAGAAGTTTTA
    AGTGATTAA
    60
    120
    180
    240
    300
    360
    369

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0444 [new locus tag: SA_RS02560 ]
  • symbol: SA0444
  • description: DNA replication intiation control protein YabA
  • length: 122
  • theoretical pI: 5.2631
  • theoretical MW: 13754.7
  • GRAVY: -0.438525

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    SH3 domain protein (TIGR04211; HMM-score: 13)
  • TheSEED:  
    Stress ResponseHeat shockHeat shock dnaK gene cluster extended DNA replication intiation control protein YabA 
  • PFAM:
    no clan definedYabB; Initiation control protein YabA (PF06156; HMM-score: 104.1)
    TSC22; TSC-22/dip/bun family (PF01166; HMM-score: 16.8)
    ZapB; Cell division protein ZapB (PF06005; HMM-score: 16.2)
    KASH_CCD; Coiled-coil region of CCDC155 or KASH (PF14662; HMM-score: 15.7)
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 14.2)
    no clan definedSpc24; Spc24 subunit of Ndc80 (PF08286; HMM-score: 13.3)
    bZIP (CL0018) bZIP_1; bZIP transcription factor (PF00170; HMM-score: 10.7)
    no clan definedNYD-SP28_assoc; Sperm tail C-terminal domain (PF14775; HMM-score: 10)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.143
    • Ymax_pos: 39
    • Cmax: 0.13
    • Cmax_pos: 39
    • Smax: 0.236
    • Smax_pos: 34
    • Smean: 0.115
    • D: 0.132
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKEALLHLDRNEIFEKIMRLEMNVNQLSKETSELKAHAVELVEENVALQLENDNLKKVLGNDEPTTIDTANSKPAKAVKKPLPSKDNLAILYGEGFHICKGELFGKHRHGEDCLFCLEVLSD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]