From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0445 [new locus tag: SA_RS02565 ]
  • pan locus tag?: SAUPAN002223000
  • symbol: SA0445
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0445 [new locus tag: SA_RS02565 ]
  • symbol: SA0445
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 517096..517821
  • length: 726
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGTTAAAAGAGAATGAACGATTTGATCAACTAATCAAAGAAGATTTTAGTATTATTCAA
    AATGATGATGTTTTTTCGTTTTCAACGGATGCTTTGTTGTTAGGGCATTTTACAAAACCT
    AGAACAAAAGATATTGTGTTGGACTTATGTTCAGGCAATGGGGTGATACCCTTGTTATTG
    TTTGCGAAACATCCACGACATATAGAAGGTGTTGAGATTCAAAAAACACTTGTCGATATG
    GCGCGACGCACATTTCAATTCAATGATGTTGATGAATATTTAACAATGCATCACATGGAT
    TTGAAAAACGTTACTAAAGTATTTAAACCTTCACAATATACTTTAGTAACGTGTAATCCG
    CCTTATTTTAAAGAGAATCAGCAACACCAACATCAAAAAGAAGCACATAAGATAGCGAGA
    CATGAGATTATGTGTACACTTGAAGATTGCATGATTGCAGCCCGTCATTTATTAAAAGAA
    GGTGGCAGGCTAAATATGGTACATCGTGCAGATAGACTAATGGATGTCTTGTTTGAAATG
    AGAAAAGTGAATATTGAACCTAAGAAAGTCGTTTTTATATATAGTAAGGTAGGGAAATCA
    GCACAAACGATAGTAGTAGAAGGTCGAAAAGGTGGAAATCAAGGTTTAGAAATCATGCCC
    CCATTTTATATTTATAATGAAGATGGTAATTATAGCGAAGAAATGAAGGACGTATATTAT
    GGATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    726

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0445 [new locus tag: SA_RS02565 ]
  • symbol: SA0445
  • description: hypothetical protein
  • length: 241
  • theoretical pI: 7.10878
  • theoretical MW: 28068.2
  • GRAVY: -0.438589

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein modification and repairprotein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 45.6)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationprotein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 37.5)
    Genetic information processingProtein fateProtein modification and repairmethyltransferase, HemK family (TIGR00536; HMM-score: 36.3)
    Unknown functionEnzymes of unknown specificityputative methylase (TIGR00537; HMM-score: 23.2)
    Genetic information processingProtein synthesistRNA and rRNA base modification23S rRNA (uracil-5-)-methyltransferase RumA (TIGR00479; EC 2.1.1.-; HMM-score: 15.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphyllmagnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 14.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinoneubiquinone/menaquinone biosynthesis methyltransferase (TIGR01934; EC 2.1.1.-; HMM-score: 12.9)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationputative protein-(glutamine-N5) methyltransferase, unknown substrate-specific (TIGR03704; EC 2.1.1.-; HMM-score: 12.7)
    MetabolismAmino acid biosynthesisAspartate familymethionine biosynthesis protein MetW (TIGR02081; HMM-score: 11.8)
  • TheSEED:  
    Heat shock dnaK gene cluster extended tRNA(1)(Val) (adenine(37)-N(6))-methyltransferase (EC 2.1.1.223) 
  • PFAM:
    NADP_Rossmann (CL0063) MTS; Methyltransferase small domain (PF05175; HMM-score: 56.4)
    Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 33.5)
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 24.8)
    Cons_hypoth95; Conserved hypothetical protein 95 (PF03602; HMM-score: 20.5)
    UPF0020; Putative RNA methylase family UPF0020 (PF01170; HMM-score: 19.6)
    Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 18.4)
    Methyltransf_10; Protein of unknown function (DUF890) (PF05971; HMM-score: 18.3)
    Methyltransf_15; RNA cap guanine-N2 methyltransferase (PF09445; HMM-score: 18.2)
    N6-adenineMlase; Probable N6-adenine methyltransferase (PF10237; HMM-score: 17.2)
    Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 17.1)
    Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 14.9)
    PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 13.2)
    N6_N4_Mtase; DNA methylase (PF01555; HMM-score: 12.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.102
    • Ymax_pos: 69
    • Cmax: 0.112
    • Cmax_pos: 63
    • Smax: 0.137
    • Smax_pos: 40
    • Smean: 0.07
    • D: 0.09
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLKENERFDQLIKEDFSIIQNDDVFSFSTDALLLGHFTKPRTKDIVLDLCSGNGVIPLLLFAKHPRHIEGVEIQKTLVDMARRTFQFNDVDEYLTMHHMDLKNVTKVFKPSQYTLVTCNPPYFKENQQHQHQKEAHKIARHEIMCTLEDCMIAARHLLKEGGRLNMVHRADRLMDVLFEMRKVNIEPKKVVFIYSKVGKSAQTIVVEGRKGGNQGLEIMPPFYIYNEDGNYSEEMKDVYYG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]