From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002223000
  • symbol?:
  • description?: tRNA1(Val) (adenine(37)-N6)-methyltransferase

      descriptions from strain specific annotations:

    • tRNA1(Val) (adenine(37)-N6)-methyltransferase
    • Methyltransferase
    • methyltransferase domain protein
    • methyltransferase small domain-containing protein
    • O-methyltransferase
    • putative methyltransferase
    • putative O-methyltransferase
  • strand?: +
  • coordinates?: 2734295..2735020
  • synteny block?: BlockID0015220
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0462
    08BA02176:
    C248_0541
    11819-97:
    MS7_0464
    71193:
    ST398NM01_0553
    ECT-R 2:
    ECTR2_427
    ED133:
    SAOV_0508
    ED98:
    SAAV_0433
    HO 5096 0412:
    SAEMRSA15_04130
    JH1:
    SaurJH1_0521
    JH9:
    SaurJH9_0508
    JKD6008:
    SAA6008_00491
    JKD6159:
    SAA6159_00438
    LGA251:
    SARLGA251_04210
    M013:
    M013TW_0456
    MRSA252:
    SAR0488
    MSHR1132:
    SAMSHR1132_04310
    MSSA476:
    SAS0444
    Mu3:
    SAHV_0484
    Mu50:
    SAV0487
    MW2:
    MW0442
    RF122:
    SAB0436
    ST398:
    SAPIG0553
    T0131:
    SAT0131_00532 (arsB)
    TCH60:
    HMPREF0772_10034
    TW20:
    SATW20_05550
    USA300_TCH1516:
    USA300HOU_0487
    VC40:
    SAVC_02020

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLKENERFDQLIKEDFSIIQNDDVFSFSTDALLLGHFTKPRTKDIVLDLCSGNGVIPLLL
    N315            MLKENERFDQLIKEDFSIIQNDDVFSFSTDALLLGHFTKPRTKDIVLDLCSGNGVIPLLL
    NCTC8325        MLKENERFDQLIKEDFSIIQNDDVFSFSTDALLLGHFTKPRTKDIVLDLCSGNGVIPLLL
    Newman          MLKENERFDQLIKEDFSIIQNDDVFSFSTDALLLGHFTKPRTKDIVLDLCSGNGVIPLLL
    USA300_FPR3757  MLKENERFDQLIKEDFSIIQNDDVFSFSTDALLLGHFTKPRTKDIVLDLCSGNGVIPLLL
                    ************************************************************

    COL             FAKHPRHIEGVEIQKTLVDMARRTFQFNDVDEYLTMHHMDLKNVTKVFKPSQYTLVTCNP
    N315            FAKHPRHIEGVEIQKTLVDMARRTFQFNDVDEYLTMHHMDLKNVTKVFKPSQYTLVTCNP
    NCTC8325        FAKHPRHIEGVEIQKTLVDMARRTFQFNDVDEYLTMHHMDLKNVTKVFKPSQYTLVTCNP
    Newman          FAKHPRHIEGVEIQKTLVDMARRTFQFNDVDEYLTMHHMDLKNVTKVFKPSQYTLVTCNP
    USA300_FPR3757  FAKHPRHIEGVEIQKTLVDMARRTFQFNDVDEYLTMHHMDLKNVTKVFKPSQYTLVTCNP
                    ************************************************************

    COL             PYFKENQQHQHQKEAHKIARHEIMCTLEDCMIAARHLLKEGGRLNMVHRAERLMDVLFEM
    N315            PYFKENQQHQHQKEAHKIARHEIMCTLEDCMIAARHLLKEGGRLNMVHRADRLMDVLFEM
    NCTC8325        PYFKENQQHQHQKEAHKIARHEIMCTLEDCMIAARHLLKEGGRLNMVHRAERLMDVLFEM
    Newman          PYFKENQQHQHQKEAHKIARHEIMCTLEDCMIAARHLLKEGGRLNMVHRAERLMDVLFEM
    USA300_FPR3757  PYFKENQQHQHQKEAHKIARHEIMCTLEDCMIAARHLLKEGGRLNMVHRAERLMDVLFEM
                    **************************************************:*********

    COL             RKVNIEPKKVVFIYSKVGKSAQTIVVEGRKGGNQGLEIMPPFYIYNEDGNYSEEMKEVYY
    N315            RKVNIEPKKVVFIYSKVGKSAQTIVVEGRKGGNQGLEIMPPFYIYNEDGNYSEEMKDVYY
    NCTC8325        RKVNIEPKKVVFIYSKVGKSAQTIVVEGRKGGNQGLEIMPPFYIYNEDGNYSEEMKEVYY
    Newman          RKVNIEPKKVVFIYSKVGKSAQTIVVEGRKGGNQGLEIMPPFYIYNEDGNYSEEMKEVYY
    USA300_FPR3757  RKVNIEPKKVVFIYSKVGKSAQTIVVEGRKGGNQGLEIMPPFYIYNEDGNYSEEMKEVYY
                    ********************************************************:***

    COL             G
    N315            G
    NCTC8325        G
    Newman          G
    USA300_FPR3757  G
                    *