From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0456 [new locus tag: SA_RS02625 ]
  • pan locus tag?: SAUPAN002236000
  • symbol: spoVG
  • pan gene symbol?: spoVG
  • synonym:
  • product: regulatory protein SpoVG

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0456 [new locus tag: SA_RS02625 ]
  • symbol: spoVG
  • product: regulatory protein SpoVG
  • replicon: chromosome
  • strand: +
  • coordinates: 526400..526702
  • length: 303
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGAAAGTGACAGATGTAAGACTTAGAAAAATACAAACAGATGGACGAATGAAAGCACTC
    GTTTCCATTACATTAGATGAAGCTTTCGTAATTCATGATTTACGTGTAATTGAAGGAAAC
    TCTGGCTTGTTCGTTGCAATGCCAAGTAAACGTACACCAGATGGTGAATTCCGCGACATC
    GCGCATCCTATTAATTCAGATATGAGACAAGAAATTCAAGATGCAGTGATGAAAGTATAT
    GATGAAACAGATGAAGTAGTACCAGATAAAAACGCTACATCAGAAGATTCAGAAGAAGCT
    TAA
    60
    120
    180
    240
    300
    303

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0456 [new locus tag: SA_RS02625 ]
  • symbol: SpoVG
  • description: regulatory protein SpoVG
  • length: 100
  • theoretical pI: 4.40086
  • theoretical MW: 11277.6
  • GRAVY: -0.511

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Dormancy and SporulationDormancy and Sporulation - no subcategorySporulation-associated proteins with broader functions Protein of unknown function identified by role in sporulation (SpoVG) 
  • PFAM:
    no clan definedSpoVG; SpoVG (PF04026; HMM-score: 123)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.147
    • Ymax_pos: 17
    • Cmax: 0.108
    • Cmax_pos: 31
    • Smax: 0.307
    • Smax_pos: 9
    • Smean: 0.21
    • D: 0.171
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFVAMPSKRTPDGEFRDIAHPINSDMRQEIQDAVMKVYDETDEVVPDKNATSEDSEEA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J. Microbiol. Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)