From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002236000
  • symbol?: spoVG
  • description?: regulatory protein SpoVG

      descriptions from strain specific annotations:

    • regulatory protein SpoVG
    • stage V sporulation protein G
    • putative septation protein spoVG
    • putative septation protein spoVG (Stage V sporulation protein G)
    • SpoVG family transcriptional regulator
    • SpoVG superfamily
  • strand?: +
  • coordinates?: 2743596..2743923
  • synteny block?: BlockID0015350
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0541 (spoVG)
    N315:
    SA0456 (spoVG)
    NCTC8325:
    Newman:
    NWMN_0461 (spoVG)
    USA300_FPR3757:
    04-02981:
    SA2981_0473 (spoVG)
    08BA02176:
    C248_0553 (spoVG)
    11819-97:
    MS7_0475 (spoVG)
    71193:
    ST398NM01_0564
    ECT-R 2:
    ECTR2_438
    ED133:
    SAOV_0520
    ED98:
    SAAV_0445 (spoVG)
    HO 5096 0412:
    SAEMRSA15_04240 (spoVG)
    JH1:
    SaurJH1_0532
    JH9:
    SaurJH9_0519
    JKD6008:
    SAA6008_00502 (spoVG)
    JKD6159:
    SAA6159_00449 (spoVG)
    LGA251:
    SARLGA251_04320 (spoVG)
    M013:
    M013TW_0469
    MRSA252:
    SAR0499 (spoVG)
    MSHR1132:
    SAMSHR1132_04420
    MSSA476:
    SAS0455
    Mu3:
    SAHV_0495 (spoVG)
    Mu50:
    SAV0498 (spoVG)
    MW2:
    MW0453 (spoVG)
    RF122:
    SAB0447 (spoVG)
    ST398:
    SAPIG0564
    T0131:
    SAT0131_00543
    TCH60:
    HMPREF0772_10022 (spoVG)
    TW20:
    SATW20_05660 (spoVG)
    USA300_TCH1516:
    VC40:
    SAVC_02075

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFVAMPSKRTPDGEFRDI
    N315            MKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFVAMPSKRTPDGEFRDI
    NCTC8325        MKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFVAMPSKRTPDGEFRDI
    Newman          MKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFVAMPSKRTPDGEFRDI
    USA300_FPR3757  MKVTDVRLRKIQTDGRMKALVSITLDEAFVIHDLRVIEGNSGLFVAMPSKRTPDGEFRDI
                    ************************************************************

    COL             AHPINSDMRQEIQDAVMKVYDETDEVVPDKNATSEDSEEA
    N315            AHPINSDMRQEIQDAVMKVYDETDEVVPDKNATSEDSEEA
    NCTC8325        AHPINSDMRQEIQDAVMKVYDETDEVVPDKNATSEDSEEA
    Newman          AHPINSDMRQEIQDAVMKVYDETDEVVPDKNATSEDSEEA
    USA300_FPR3757  AHPINSDMRQEIQDAVMKVYDETDEVVPDKNATSEDSEEA
                    ****************************************