From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0513 [new locus tag: SA_RS02995 ]
  • pan locus tag?: SAUPAN002328000
  • symbol: SA0513
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0513 [new locus tag: SA_RS02995 ]
  • symbol: SA0513
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 600574..601257
  • length: 684
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGAATGGATATTATTTGATAAAGATGGTACGTTAATTGAATTTGATAGAAGTTGGGAA
    AAAATAGGGGTACGATTTGTACAATCATTGCTTGAGACTTTCCCAGTACATAATAAAGAA
    GCTGCTTTAAGACAACTCGGTGTCATTAAAGAATCTATTGATCCAAAATCAGTGATGGGT
    TCAGGATCTTTACAACAAATTATCCAGGCATTTAATGATGTGACGGGACAAGATACAACC
    GACTGGTCCAAGTCAACAAGTCAAAAGCTGGTAGATGAACGTATTCCTGAAATTAATTGG
    GTAGAAGGTGTTAAAGAAGCACTTATCGATTTGAAAGCAAAAGGCTATCAACTTGGTATT
    GTTACGAGTGATACTAAAAAAGGTGTAGAACAATTTTTAGCACATACCAATGCTATCTCG
    TTGTTCGATTTGATCATTTCTACCGAAGCGGATGCCTATGAGAAGCCAAATCCTAAAGTA
    TTATCGCCTTTATTTGAGCAATATAATGTAGATCCTCAGAAAGTAGCTATAGTAGGAGAC
    ACTGCTAATGATATGAAGACAGCAAGTAATGCAAATTTAGGTATGGCAATAGGTGTATTA
    ACAGGTATTGCAACAAAAGAAGAATTACATGAAGCTGATATTATTTTAAATAGTGCGGCA
    GATATTTTAGAAGCTTTAAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    684

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0513 [new locus tag: SA_RS02995 ]
  • symbol: SA0513
  • description: hypothetical protein
  • length: 227
  • theoretical pI: 4.35345
  • theoretical MW: 25004.2
  • GRAVY: -0.151982

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    HAD hydrolase, TIGR02253 family (TIGR02253; HMM-score: 69.3)
    MetabolismEnergy metabolismSugarsphosphoglycolate phosphatase, bacterial (TIGR01449; EC 3.1.3.18; HMM-score: 59.8)
    phosphonatase-like hydrolase (TIGR03351; HMM-score: 57)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IIIA (TIGR01662; HMM-score: 54.9)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IA, variant 1 (TIGR01549; HMM-score: 46.1)
    AHBA synthesis associated protein (TIGR01454; HMM-score: 43.7)
    histidinol-phosphate phosphatase domain (TIGR01656; HMM-score: 41.2)
    HAD hydrolase, REG-2-like, family IA (TIGR02252; HMM-score: 39.8)
    noncanonical pyrimidine nucleotidase, YjjG family (TIGR02254; EC 3.1.3.5; HMM-score: 37.2)
    HAD hydrolase, TIGR01548 family (TIGR01548; HMM-score: 34.2)
    haloacid dehalogenase, type II (TIGR01428; EC 3.8.1.2; HMM-score: 33.6)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesD,D-heptose 1,7-bisphosphate phosphatase (TIGR00213; HMM-score: 33.5)
    MetabolismAmino acid biosynthesisSerine familyphosphoserine phosphatase SerB (TIGR00338; EC 3.1.3.3; HMM-score: 30.2)
    beta-phosphoglucomutase family hydrolase (TIGR02009; HMM-score: 30.2)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharidesbeta-phosphoglucomutase (TIGR01990; EC 5.4.2.6; HMM-score: 28.9)
    MetabolismAmino acid biosynthesisHistidine familyhistidinol-phosphatase (TIGR01261; EC 3.1.3.15; HMM-score: 27.6)
    epoxide hydrolase N-terminal domain-like phosphatase (TIGR02247; HMM-score: 26.7)
    MetabolismCentral intermediary metabolismOtherphosphonoacetaldehyde hydrolase (TIGR01422; EC 3.11.1.1; HMM-score: 26.2)
    phosphoserine phosphatase-like hydrolase, archaeal (TIGR01491; HMM-score: 25.2)
    Unknown functionEnzymes of unknown specificityHAD phosphoserine phosphatase-like hydrolase, family IB (TIGR01488; HMM-score: 24.3)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IA, variant 3 (TIGR01509; HMM-score: 24)
    HAD hydrolase, family IA, variant 2 (TIGR01493; HMM-score: 22.7)
    Cellular processesCellular processesDetoxificationcopper-translocating P-type ATPase (TIGR01511; EC 3.6.3.4; HMM-score: 22.4)
    MetabolismTransport and binding proteinsCations and iron carrying compoundscopper-translocating P-type ATPase (TIGR01511; EC 3.6.3.4; HMM-score: 22.4)
    pyrimidine 5'-nucleotidase (TIGR01993; EC 3.1.3.5; HMM-score: 21.7)
    heavy metal translocating P-type ATPase (TIGR01525; EC 3.6.3.-; HMM-score: 21.1)
    Unknown functionEnzymes of unknown specificityCof-like hydrolase (TIGR00099; HMM-score: 20.1)
    DNA 3'-phosphatase (TIGR01664; EC 3.1.3.32; HMM-score: 19.3)
    phosphoglycolate/pyridoxal phosphate phosphatase family (TIGR01452; EC 3.1.3.18; HMM-score: 17.4)
    phosphoglycolate phosphatase, TA0175-type (TIGR01487; EC 3.1.3.18; HMM-score: 15.9)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IIB (TIGR01484; HMM-score: 15.3)
    HAD ATPase, P-type, family IC (TIGR01494; EC 3.6.3.-; HMM-score: 14.1)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharides3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family (TIGR01670; EC 3.1.3.45; HMM-score: 13.7)
    MetabolismTransport and binding proteinsCations and iron carrying compoundscadmium-translocating P-type ATPase (TIGR01512; EC 3.6.3.3; HMM-score: 12.6)
  • TheSEED:  
    Hydrolase, haloacid dehalogenase-like family 
  • PFAM:
    HAD (CL0137) HAD_2; haloacid dehalogenase-like hydrolase (PF13419; HMM-score: 99.1)
    Hydrolase; haloacid dehalogenase-like hydrolase (PF00702; HMM-score: 64.8)
    Hydrolase_like; HAD-hyrolase-like (PF13242; HMM-score: 40)
    HAD; haloacid dehalogenase-like hydrolase (PF12710; HMM-score: 32.9)
    Hydrolase_3; haloacid dehalogenase-like hydrolase (PF08282; HMM-score: 22.5)
    Hydrolase_6; haloacid dehalogenase-like hydrolase (PF13344; HMM-score: 17.7)
    PNK3P; Polynucleotide kinase 3 phosphatase (PF08645; HMM-score: 16.7)
    Put_Phosphatase; Putative Phosphatase (PF06888; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.128
    • Ymax_pos: 42
    • Cmax: 0.133
    • Cmax_pos: 42
    • Smax: 0.233
    • Smax_pos: 38
    • Smean: 0.072
    • D: 0.106
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MEWILFDKDGTLIEFDRSWEKIGVRFVQSLLETFPVHNKEAALRQLGVIKESIDPKSVMGSGSLQQIIQAFNDVTGQDTTDWSKSTSQKLVDERIPEINWVEGVKEALIDLKAKGYQLGIVTSDTKKGVEQFLAHTNAISLFDLIISTEADAYEKPNPKVLSPLFEQYNVDPQKVAIVGDTANDMKTASNANLGMAIGVLTGIATKEELHEADIILNSAADILEALN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]