From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002328000
  • symbol?:
  • description?: HAD family hydrolase

      descriptions from strain specific annotations:

    • HAD family hydrolase
    • haloacid dehalogenase-like hydrolase
    • HAD superfamily hydrolase
    • HAD hydrolase family protein
    • haloacid dehalogenase-like family hydrolase
    • Hydrolase, haloacid dehalogenase-like family
    • phosphoglycolate phosphatase
  • strand?: +
  • coordinates?: 2848864..2849556
  • synteny block?: BlockID0016270
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0532
    08BA02176:
    C248_0630
    11819-97:
    MS7_0545
    71193:
    ST398NM01_0630
    ECT-R 2:
    ECTR2_509
    ED133:
    SAOV_0590
    ED98:
    SAAV_0518
    HO 5096 0412:
    SAEMRSA15_04820
    JH1:
    SaurJH1_0592
    JH9:
    SaurJH9_0578
    JKD6008:
    SAA6008_00562
    JKD6159:
    SAA6159_00509
    LGA251:
    SARLGA251_04910
    M013:
    M013TW_0542
    MRSA252:
    SAR0560
    MSHR1132:
    SAMSHR1132_04990
    MSSA476:
    SAS0513
    Mu3:
    SAHV_0553
    Mu50:
    SAV0555
    MW2:
    MW0510
    RF122:
    SAB0506
    ST398:
    SAPIG0630
    T0131:
    SAT0131_00609 (cbf1)
    TCH60:
    HMPREF0772_12634
    TW20:
    SATW20_06250
    USA300_TCH1516:
    USA300HOU_0549
    VC40:
    SAVC_02370

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEWILFDKDGTLIEFDRSWEKIGVRFVQSLLETFPVHNKEAALRQLGVIKESIDPKSVMG
    N315            MEWILFDKDGTLIEFDRSWEKIGVRFVQSLLETFPVHNKEAALRQLGVIKESIDPKSVMG
    NCTC8325        MEWILFDKDGTLIEFDRSWEKIGVRFVQSLLETFPVHNKEAALRQLGVIKESIDPKSVMG
    Newman          MEWILFDKDGTLIEFDRSWEKIGVRFVQSLLETFPVHNKEAALRQLGVIKESIDPKSVMG
    USA300_FPR3757  MEWILFDKDGTLIEFDRSWEKIGVRFVQSLLETFPVHNKEAALRQLGVIKESIDPKSVMG
                    ************************************************************

    COL             SGSLQQIIQAFNDVTGQDTTDWSKSTSQKLVDERIPEINWVEGVKEALIDLKAKGYQLGI
    N315            SGSLQQIIQAFNDVTGQDTTDWSKSTSQKLVDERIPEINWVEGVKEALIDLKAKGYQLGI
    NCTC8325        SGSLQQIIQAFNDVTGQDTTDWSKSTSQKLVDERIPEINWVEGVKEALIDLKAKGYQLGI
    Newman          SGSLQQIIQAFNDVTGQDTTDWSKSTSQKLVDERIPEINWVEGVKEALIDLKAKGYQLGI
    USA300_FPR3757  SGSLQQIIQAFNDVTGQDTTDWSKSTSQKLVDERIPEINWVEGVKEALIDLKAKGYQLGI
                    ************************************************************

    COL             VTSDTKKGVEQFLAHTNATSLFDLIISTEADAYEKPNPKVLSPLFEQYNVDPQKVAIVGD
    N315            VTSDTKKGVEQFLAHTNAISLFDLIISTEADAYEKPNPKVLSPLFEQYNVDPQKVAIVGD
    NCTC8325        VTSDTKKGVEQFLAHTNATSLFDLIISTEADAYEKPNPKVLSPLFEQYNVDPQKVAIVGD
    Newman          VTSDTKKGVEQFLAHTNATSLFDLIISTEADAYEKPNPKVLSPLFEQYNVDPQKVAIVGD
    USA300_FPR3757  VTSDTKKGVEQFLAHTNATSLFDLIISTEADAYEKPNPKVLSPLFEQYNVDPQKVAIVGD
                    ****************** *****************************************

    COL             TANDMKTASNANLGMAIGVLTGIATKEELHEADIILNSAADILEALN
    N315            TANDMKTASNANLGMAIGVLTGIATKEELHEADIILNSAADILEALN
    NCTC8325        TANDMKTASNANLGMAIGVLTGIATKEELHEADIILNSAADILEALN
    Newman          TANDMKTASNANLGMAIGVLTGIATKEELHEADIILNSAADILEALN
    USA300_FPR3757  TANDMKTASNANLGMAIGVLTGIATKEELHEADIILNSAADILEALN
                    ***********************************************