From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0518 [new locus tag: SA_RS03020 ]
  • pan locus tag?: SAUPAN002333000
  • symbol: SA0518
  • pan gene symbol?: azo1
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0518 [new locus tag: SA_RS03020 ]
  • symbol: SA0518
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 604220..604786
  • length: 567
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAAGGATTAATTATTATTGGCAGTGCACAAGTGAATTCACATACAAGTGCACTAGCA
    AGATACTTAACTGAGCATTTTAAAACACATGATATTGAAGCGGAAATATTCGATTTAGCA
    GAAAAACCGTTAAATCAATTAGATTTTTCAGGAACAACACCGTCTATTGATGAAATCAAA
    CAAAATATGAAAGATTTAAAAGAGAAAGCAATGGCGGCGGACTTTTTAATATTAGGAACG
    CCAAACTATCATGGTTCATATTCTGGAATATTGAAAAATGCATTAGATCATCTAAATATG
    GATTATTTTAAAATGAAACCTGTAGGCTTAATAGGAAATAGTGGTGGTATTGTTAGTTCA
    GAGCCATTGTCACATTTAAGAGTAATCGTCAGAAGTTTACTAGGCATTGCTGTACCAACT
    CAAATAGCAACACATGATTCTGATTTTGCTAAAAATGAAGATGGTTCATATTACTTAAAT
    GATAGTGAATTCCAATTACGAGCAAGATTATTTGTCGATCAAATTGTATCTTTTGTGAAT
    AATAGTCCATATGAACATTTAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    567

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0518 [new locus tag: SA_RS03020 ]
  • symbol: SA0518
  • description: hypothetical protein
  • length: 188
  • theoretical pI: 6.07624
  • theoretical MW: 20911.6
  • GRAVY: -0.191489

Function[edit source | edit]

  • reaction:
    EC 1.7.-.-?  ExPASy
  • TIGRFAM:
    FMN reductase (TIGR03566; EC 1.5.1.-; HMM-score: 54.1)
    MetabolismCentral intermediary metabolismSulfur metabolismFMN reductase (TIGR03567; EC 1.5.1.38; HMM-score: 48.9)
    LLM-partnered FMN reductase, CE1759 family (TIGR04037; EC 1.-.-.-; HMM-score: 35.4)
    Cellular processesCellular processesDetoxificationarsenical resistance protein ArsH (TIGR02690; HMM-score: 30.1)
    Genetic information processingProtein synthesisTranslation factorsribosome silencing factor (TIGR00090; HMM-score: 13)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidescytidine deaminase (TIGR01355; EC 3.5.4.5; HMM-score: 11.5)
  • TheSEED:  
    Predicted flavoprotein 
  • PFAM:
    Flavoprotein (CL0042) FMN_red; NADPH-dependent FMN reductase (PF03358; HMM-score: 100.7)
    Flavodoxin_2; Flavodoxin-like fold (PF02525; HMM-score: 42.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: FMN
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 0.83
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.263
    • Ymax_pos: 21
    • Cmax: 0.216
    • Cmax_pos: 21
    • Smax: 0.449
    • Smax_pos: 18
    • Smean: 0.281
    • D: 0.27
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKGLIIIGSAQVNSHTSALARYLTEHFKTHDIEAEIFDLAEKPLNQLDFSGTTPSIDEIKQNMKDLKEKAMAADFLILGTPNYHGSYSGILKNALDHLNMDYFKMKPVGLIGNSGGIVSSEPLSHLRVIVRSLLGIAVPTQIATHDSDFAKNEDGSYYLNDSEFQLRARLFVDQIVSFVNNSPYEHLK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]