From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002333000
  • symbol?: azo1
  • description?: azobenzene reductase

      descriptions from strain specific annotations:

    • azobenzene reductase
    • FMN-dependent NADPH-azoreductase
    • putative flavo protein
    • flavoprotein
    • putative FMN-dependent NADPH-azoreductase
    • NADPH-dependent FMN reductase family protein
    • acyl carrier protein phosphodiesterase
    • fmn-dependent NADPH-azoreductase (nadph-dependent flavo-azoreductase) (nadph-flavin azoreductase)
  • strand?: +
  • coordinates?: 2852485..2853089
  • synteny block?: BlockID0016320
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0537
    08BA02176:
    C248_0635
    11819-97:
    MS7_0550 (azo1)
    71193:
    ST398NM01_0635
    ECT-R 2:
    ECTR2_514
    ED133:
    SAOV_0595
    ED98:
    SAAV_0523
    HO 5096 0412:
    SAEMRSA15_04870
    JH1:
    SaurJH1_0597
    JH9:
    SaurJH9_0583
    JKD6008:
    SAA6008_00567 (azo1)
    JKD6159:
    SAA6159_00514 (azo1)
    LGA251:
    SARLGA251_04960 (azo1)
    M013:
    M013TW_0547
    MRSA252:
    SAR0565
    MSHR1132:
    SAMSHR1132_05040
    MSSA476:
    SAS0518
    Mu3:
    SAHV_0558
    Mu50:
    SAV0560
    MW2:
    MW0515
    RF122:
    SAB0511
    ST398:
    SAPIG0635
    T0131:
    SAT0131_00614
    TCH60:
    HMPREF0772_12629 (azr)
    TW20:
    SATW20_06300 (azo1)
    USA300_TCH1516:
    USA300HOU_0554
    VC40:
    SAVC_02395

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKGLIIIGSAQVNSHTSALARYLTEHFKTHDIEAEIFDLAEKPLNQLDFSGTTPSIDEIK
    N315            MKGLIIIGSAQVNSHTSALARYLTEHFKTHDIEAEIFDLAEKPLNQLDFSGTTPSIDEIK
    NCTC8325        MKGLIIIGSAQVNSHTSALARYLTEHFKTHDIEAEIFDLAEKPLNQLDFSGTTPSIDEIK
    Newman          MKGLIIIGSAQVNSHTSALARYLTEHFKTHDIEAEIFDLAEKPLNQLDFSGTTPSIDEIK
    USA300_FPR3757  MKGLIIIGSAQVNSHTSALARYLTEHFKTHDIEAEIFDLAEKPLNQLDFSGTTPSIDEIK
                    ************************************************************

    COL             QNMKDLKEKAMAADFLILGTPNYHGSYSGILKNALDHLNMDYFKMKPVGLIGNSGGIVSS
    N315            QNMKDLKEKAMAADFLILGTPNYHGSYSGILKNALDHLNMDYFKMKPVGLIGNSGGIVSS
    NCTC8325        QNMKDLKEKAMAADFLILGTPNYHGSYSGILKNALDHLNMDYFKMKPVGLIGNSGGIVSS
    Newman          QNMKDLKEKAMAADFLILGTPNYHGSYSGILKNALDHLNMDYFKMKPVGLIGNSGGIVSS
    USA300_FPR3757  QNMKDLKEKAMAADFLILGTPNYHGSYSGILKNALDHLNMDYFKMKPVGLIGNSGGIVSS
                    ************************************************************

    COL             EPLSHLRVIVRSLLGIAVPTQIATHDSDFAKNEDGSYYLNDSEFQLRARLFVDQIVSFVN
    N315            EPLSHLRVIVRSLLGIAVPTQIATHDSDFAKNEDGSYYLNDSEFQLRARLFVDQIVSFVN
    NCTC8325        EPLSHLRVIVRSLLGIAVPTQIATHDSDFAKNEDGSYYLNDSEFQLRARLFVDQIVSFVN
    Newman          EPLSHLRVIVRSLLGIAVPTQIATHDSDFAKNEDGSYYLNDSEFQLRARLFVDQIVSFVN
    USA300_FPR3757  EPLSHLRVIVRSLLGIAVPTQIATHDSDFAKNEDGSYYLNDSEFQLRARLFVDQIVSFVN
                    ************************************************************

    COL             NSPYEHLK
    N315            NSPYEHLK
    NCTC8325        NSPYEHLK
    Newman          NSPYEHLK
    USA300_FPR3757  NSPYEHLK
                    ********