From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0759 [new locus tag: SA_RS04325 ]
  • pan locus tag?: SAUPAN002820000
  • symbol: SA0759
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0759 [new locus tag: SA_RS04325 ]
  • symbol: SA0759
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 865213..865569
  • length: 357
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGATTAAATTTTACCAATATAAGAATTGTACAACTTGTAAAAAGGCAGCAAAGTTTTTA
    GATGAATATGGCGTAAGTTATGAACCAATTGATATCGTTCAACATACACCTACAATAAAT
    GAATTTAAAACAATAATTGCAAATACAGGCGTAGAAATTAATAAATTGTTTAATACACAC
    GGTGCGAAATATCGTGAGCTTGATTTGAAAAATAAATTACAAACTTTATCAGATGATGAA
    AAGTTAGAGTTGTTATCATCTGATGGTATGTTAGTAAAGCGTCCTCTAGCAGTAATGGGC
    GATAAGATAACATTAGGATTTAAAGAAGATCAATATAAAGAGACTTGGTTAGCGTAA
    60
    120
    180
    240
    300
    357

Protein[edit source | edit]

Protein Data Bank: 2M46

General[edit source | edit]

  • locus tag: SA0759 [new locus tag: SA_RS04325 ]
  • symbol: SA0759
  • description: hypothetical protein
  • length: 118
  • theoretical pI: 7.40662
  • theoretical MW: 13599.6
  • GRAVY: -0.445763

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator, Spx/MgsR family (TIGR01617; HMM-score: 155)
    glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 40.2)
    Cellular processesCellular processesDetoxificationarsenate reductase (glutaredoxin) (TIGR00014; EC 1.20.4.1; HMM-score: 39.4)
    glutaredoxin-like protein NrdH (TIGR02194; HMM-score: 32.5)
    Unknown functionGeneralnitrogenase-associated protein (TIGR01616; HMM-score: 30.5)
    glutaredoxin-like protein (TIGR02200; HMM-score: 24.3)
    MetabolismEnergy metabolismElectron transportglutaredoxin 3 (TIGR02181; HMM-score: 22.5)
    glutaredoxin-family domain (TIGR02190; HMM-score: 12.7)
  • TheSEED:  
    Anaerobic respiratory reductases FIG138056: a glutathione-dependent thiol reductase 
    Arsenic resistance FIG138056: a glutathione-dependent thiol reductase 
  • PFAM:
    Thioredoxin (CL0172) ArsC; ArsC family (PF03960; HMM-score: 52.6)
    Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 31.4)
    Concanavalin (CL0004) Spike_NTD; Spike glycoprotein N-terminal domain (PF16451; HMM-score: 12.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.19
    • Ymax_pos: 11
    • Cmax: 0.122
    • Cmax_pos: 65
    • Smax: 0.48
    • Smax_pos: 3
    • Smean: 0.372
    • D: 0.261
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFNTHGAKYRELDLKNKLQTLSDDEKLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]