From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0771 [new locus tag: SA_RS04405 ]
  • pan locus tag?: SAUPAN002840000
  • symbol: SA0771
  • pan gene symbol?: metQ1
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0771 [new locus tag: SA_RS04405 ]
  • symbol: SA0771
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 877329..878150
  • length: 822
  • essential: yes DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAAAAAATTATTTGGTCTTATTTTAGTATTAACATTTGCAGTTGTATTAGCAGCTTGC
    GGTAATGGAAACAAAAGTGGCAGTGACGATAAGAAAATAACAGTAGGTGCTTCACCAGCA
    CCACATGCTGAAATTTTAGAAAAAGCAAAACCATTATTAGAGAAAAAAGGTTATGACCTA
    GATATTAAAACAATTAACGATTACACTACGCCTAATAAATTACTAGATAAAGGTGAAATT
    GACGCAAACTATTTCCAACATACACCATATTTAAACACAGAGAAAAAGGATAAAGGTTAC
    AAAATCGTAAGTGCCGGTGATGTTCACTTAGAACCTATGGCTGTATACTCTAAAAAGTAT
    AAAAGTTTAAAAGAATTACCAAAAGGTGCGACAGTTTATGTGTCTAATAATCCAGCTGAA
    CAAGGACGCTTCTTAAAATTCTTCGTTGATGCAGGTTTAATTAAGATCAAAAAAGGCGTA
    AAAATTGAAGATGCTAAGTTTAGTGATATTACAGAGAATAAAAAAGATATTAAGTTTAAT
    AATAAACAATCAGCAGAATTCTTACCTAAAATTTATCAAAATGAAGACGCTGATGCTGTT
    ATCATTAATTCAAACTTTGCAATCGAACAAAAACTAAATCCTAAAAAAGATTCTATTGCT
    GTAGAAAGTGCGAAAGATAATCCTTATGCAAACTTAATTGCTGTTAAAGAAGGACATCAA
    GATGATAAGAAAATCAAAGCATTAATTGAAGTATTACAATCTAAAGATATTCAAGACTTC
    ATTAATGAAAAATACAACGGTGCAGTTATTCCTGCTAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    822

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0771 [new locus tag: SA_RS04405 ]
  • symbol: SA0771
  • description: hypothetical protein
  • length: 273
  • theoretical pI: 9.49386
  • theoretical MW: 30336.7
  • GRAVY: -0.484615

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cell structureCell envelopeOtherlipoprotein, YaeC family (TIGR00363; HMM-score: 168.9)
  • TheSEED:  
    Amino Acids and DerivativesLysine, threonine, methionine, and cysteineMethionine Biosynthesis Methionine ABC transporter substrate-binding protein 
    Lysine, threonine, methionine, and cysteineMethionine Degradation Methionine ABC transporter substrate-binding protein 
    Phages, Prophages, Transposable elements, PlasmidsPathogenicity islandsStaphylococcal pathogenicity islands SaPI Methionine ABC transporter substrate-binding protein 
  • PFAM:
    PBP (CL0177) Lipoprotein_9; NLPA lipoprotein (PF03180; HMM-score: 291.5)
    OpuAC; Substrate binding domain of ABC-type glycine betaine transport system (PF04069; HMM-score: 18.6)
    Phosphonate-bd; ABC transporter, phosphonate, periplasmic substrate-binding protein (PF12974; HMM-score: 16.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 9.68
    • Cellwall Score: 0.17
    • Extracellular Score: 0.16
    • Internal Helix: 1
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular Possibility: -0.33
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: VVLAACG
  • SignalP: Signal peptide length 29 aa
    • Ymax: 0.426
    • Ymax_pos: 29
    • Cmax: 0.334
    • Cmax_pos: 29
    • Smax: 0.908
    • Smax_pos: 8
    • Smean: 0.716
    • D: 0.539
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKLFGLILVLTFAVVLAACGNGNKSGSDDKKITVGASPAPHAEILEKAKPLLEKKGYDLDIKTINDYTTPNKLLDKGEIDANYFQHTPYLNTEKKDKGYKIVSAGDVHLEPMAVYSKKYKSLKELPKGATVYVSNNPAEQGRFLKFFVDAGLIKIKKGVKIEDAKFSDITENKKDIKFNNKQSAEFLPKIYQNEDADAVIINSNFAIEQKLNPKKDSIAVESAKDNPYANLIAVKEGHQDDKKIKALIEVLQSKDIQDFINEKYNGAVIPAK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulators: SAM, CodY
    SAM (RNA) important in Methionine biosynthesis  RegPrecise
    CodY (TF) important in Amino acid metabolism  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]