From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002840000
  • symbol?: metQ1
  • description?: methionine ABC transporter substrate-binding protein

      descriptions from strain specific annotations:

    • methionine ABC transporter substrate-binding protein
    • ABC transporter substrate-binding protein
    • ABC superfamily ATP binding cassette transporter, binding protein
    • ABC transporter, substrate-binding protein
    • ABC transporter ATP-binding protein
    • methionine ABC superfamily ATP binding cassette transporter, binding protein
    • methionine-binding lipoprotein metQ
    • NLPA lipofamily protein
    • NLPA lipoprotein
    • putative lipoprotein
    • substrate-binding ABC transporter protein
  • strand?: +
  • coordinates?: 3291466..3292287
  • synteny block?: BlockID0020240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0794
    08BA02176:
    C248_0908
    11819-97:
    MS7_0866 (metQ)
    71193:
    ST398NM01_0894
    ECT-R 2:
    ECTR2_766
    ED133:
    SAOV_0856
    ED98:
    SAAV_0786
    HO 5096 0412:
    SAEMRSA15_07420
    JH1:
    SaurJH1_0856
    JH9:
    SaurJH9_0840
    JKD6008:
    SAA6008_00837
    JKD6159:
    SAA6159_00770
    LGA251:
    SARLGA251_07450
    M013:
    M013TW_0805
    MRSA252:
    SAR0872
    MSHR1132:
    SAMSHR1132_07630
    MSSA476:
    SAS0781
    Mu3:
    SAHV_0835
    Mu50:
    SAV0839
    MW2:
    MW0792
    RF122:
    SAB0770
    ST398:
    SAPIG0894
    T0131:
    SAT0131_00914
    TCH60:
    HMPREF0772_12364 (metQ)
    TW20:
    SATW20_08880
    USA300_TCH1516:
    USA300HOU_0849
    VC40:
    SAVC_03730

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKLFGLILVLTFAVVLAACGNGNKSGSDDKKITVGASPAPHAEILEKAKPLLEKKGYEL
    N315            MKKLFGLILVLTFAVVLAACGNGNKSGSDDKKITVGASPAPHAEILEKAKPLLEKKGYDL
    NCTC8325        MKKLFGLILVLTFAVVLAACGNGNKSGSDDKKITVGASPAPHAEILEKAKPLLEKKGYEL
    Newman          MKKLFGLILVLTFAVVLAACGNGNKSGSDDKKITVGASPAPHAEILEKAKPLLEKKGYEL
    USA300_FPR3757  MKKLFGLILVLTFAVVLAACGNGNKSGSDDKKITVGASPAPHAEILEKAKPLLEKKGYEL
                    **********************************************************:*

    COL             DIKTINDYTTPNKLLDKGEIDANYFQHTPYLNTEKKDKGYKIVSAGDVHLEPMAVYSKKY
    N315            DIKTINDYTTPNKLLDKGEIDANYFQHTPYLNTEKKDKGYKIVSAGDVHLEPMAVYSKKY
    NCTC8325        DIKTINDYTTPNKLLDKGEIDANYFQHTPYLNTEKKDKGYKIVSAGDVHLEPMAVYSKKY
    Newman          DIKTINDYTTPNKLLDKGEIDANYFQHTPYLNTEKKDKGYKIVSAGDVHLEPMAVYSKKY
    USA300_FPR3757  DIKTINDYTTPNKLLDKGEIDANYFQHTPYLNTEKKDKGYKIVSAGDVHLEPMAVYSKKY
                    ************************************************************

    COL             KSLKELPKGATVYVSNNPAEQGRFLKFFVDAGLIKIKKGVKIEDAKFSDITENKKDIKFN
    N315            KSLKELPKGATVYVSNNPAEQGRFLKFFVDAGLIKIKKGVKIEDAKFSDITENKKDIKFN
    NCTC8325        KSLKELPKGATVYVSNNPAEQGRFLKFFVDAGLIKIKKGVKIEDAKFSDITENKKDIKFN
    Newman          KSLKELPKGATVYVSNNPAEQGRFLKFFVDAGLIKIKKGVKIEDAKFSDITENKKDIKFN
    USA300_FPR3757  KSLKELPKGATVYVSNNPAEQGRFLKFFVDAGLIKIKKGVKIEDAKFSDITENKKDIKFN
                    ************************************************************

    COL             NKQSAEFLPKIYQNEDADAVIINSNFAIEQKLNPKKDSIAVESAKDNPYANLIAVKEGHQ
    N315            NKQSAEFLPKIYQNEDADAVIINSNFAIEQKLNPKKDSIAVESAKDNPYANLIAVKEGHQ
    NCTC8325        NKQSAEFLPKIYQNEDADAVIINSNFAIEQKLNPKKDSIAVESAKDNPYANLIAVKEGHQ
    Newman          NKQSAEFLPKIYQNEDADAVIINSNFAIEQKLNPKKDSIAVESAKDNPYANLIAVKEGHQ
    USA300_FPR3757  NKQSAEFLPKIYQNEDADAVIINSNFAIEQKLNPKKDSIAVESAKDNPYANLIAVKEGHQ
                    ************************************************************

    COL             DDKKIKALIEVLQSKDIQDFINEKYNGAVIPAK
    N315            DDKKIKALIEVLQSKDIQDFINEKYNGAVIPAK
    NCTC8325        DDKKIKALIEVLQSKDIQDFINEKYNGAVIPAK
    Newman          DDKKIKALIEVLQSKDIQDFINEKYNGAVIPAK
    USA300_FPR3757  DDKKIKALIEVLQSKDIQDFINEKYNGAVIPAK
                    *********************************