From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0772 [new locus tag: SA_RS04410 ]
  • pan locus tag?: SAUPAN002892000
  • symbol: SA0772
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0772 [new locus tag: SA_RS04410 ]
  • symbol: SA0772
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 878504..878698
  • length: 195
  • essential: yes [1] DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGGCAGACGAAAGTAAATTTGAACAAGCAAAAGGTAATGTTAAAGAAACAGTAGGTAAT
    GTTACTGATAATAAAAATTTAGAAAACGAAGGTAAAGAAGATAAAGCTTCTGGTAAAGCG
    AAAGAATTCGTTGAAAATGCAAAAGAAAAAGCAACTGATTTTATTGATAAAGTAAAAGGT
    AACAAAGGCGAGTAA
    60
    120
    180
    195

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0772 [new locus tag: SA_RS04410 ]
  • symbol: SA0772
  • description: hypothetical protein
  • length: 64
  • theoretical pI: 4.86657
  • theoretical MW: 7018.64
  • GRAVY: -1.35781

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG01108089: hypothetical protein 
  • PFAM:
    YjbJ-CsbD-like (CL0406) CsbD; CsbD-like (PF05532; HMM-score: 57.7)
    no clan definedMT0933_antitox; MT0933-like antitoxin protein (PF14013; HMM-score: 14.1)
    YtxH; YtxH-like protein (PF12732; HMM-score: 13.7)
    LEA_4; Late embryogenesis abundant protein (PF02987; HMM-score: 13.4)
    HSP9_HSP12; Heat shock protein 9/12 (PF04119; HMM-score: 12.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.143
    • Ymax_pos: 36
    • Cmax: 0.113
    • Cmax_pos: 3
    • Smax: 0.219
    • Smax_pos: 32
    • Smean: 0.142
    • D: 0.143
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MADESKFEQAKGNVKETVGNVTDNKNLENEGKEDKASGKAKEFVENAKEKATDFIDKVKGNKGE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
    A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
    Mol. Microbiol.: 2002, 43(6);1387-400
    [PubMed:11952893] [WorldCat.org] (P p)

Relevant publications[edit source | edit]