From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0892 [new locus tag: SA_RS05065 ]
  • pan locus tag?: SAUPAN003240000
  • symbol: SA0892
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0892 [new locus tag: SA_RS05065 ]
  • symbol: SA0892
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1013051..1013266
  • length: 216
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGAAAGTCAATAAAGCCATTTATGTTATTGTTGCATTATTTCTTGGAGGTTTAGGTATT
    CATAAATTTTATGCTGATAAATTTGGACAAGGTCTTTTTCACTTATTATTTTTCTGGACA
    GGTATCCCTACCATCATCTCAATAATACATGCAATTTTTGTCATTTTTACTAAAAAAGCA
    GATAAAGATGGTTATATTATATTCCCTAAAAATTAA
    60
    120
    180
    216

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0892 [new locus tag: SA_RS05065 ]
  • symbol: SA0892
  • description: hypothetical protein
  • length: 71
  • theoretical pI: 10.3505
  • theoretical MW: 8060.67
  • GRAVY: 0.76338

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein modification and repaircytochrome oxidase maturation protein, cbb3-type (TIGR00847; HMM-score: 5.2)
    MetabolismEnergy metabolismElectron transportcytochrome oxidase maturation protein, cbb3-type (TIGR00847; HMM-score: 5.2)
  • TheSEED:  
    FIG01108199: hypothetical protein 
  • PFAM:
    no clan definedTM2; TM2 domain (PF05154; HMM-score: 57.6)
    2TM; 2TM domain (PF13239; HMM-score: 13.5)
    Psm4; Phenol-soluble modulin alpha 4 peptide (PF17063; HMM-score: 9.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.172
    • Ymax_pos: 26
    • Cmax: 0.197
    • Cmax_pos: 26
    • Smax: 0.326
    • Smax_pos: 2
    • Smean: 0.188
    • D: 0.178
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKVNKAIYVIVALFLGGLGIHKFYADKFGQGLFHLLFFWTGIPTIISIIHAIFVIFTKKADKDGYIIFPKN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA0892 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]