From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0973 [new locus tag: SA_RS05510 ]
  • pan locus tag?: SAUPAN003352000
  • symbol: coaD
  • pan gene symbol?: coaD
  • synonym:
  • product: phosphopantetheine adenylyltransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0973 [new locus tag: SA_RS05510 ]
  • symbol: coaD
  • product: phosphopantetheine adenylyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 1101884..1102366
  • length: 483
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGAACATACAATAGCGGTCATTCCGGGTAGTTTTGACCCCATTACTTATGGTCATTTA
    GACATTATTGAGAGAAGTACAGATAGATTTGATGAAATTCATGTCTGTGTTCTTAAAAAT
    AGTAAAAAAGAAGGTACGTTTAGTTTAGAAGAGCGTATGGATTTAATTGAACAATCTGTT
    AAACATTTACCTAATGTCAAGGTTCATCAATTTAGTGGTTTACTAGTCGATTATTGTGAA
    CAAGTAGGAGCTAAAACAATCATACGTGGTTTAAGAGCAGTCAGTGATTTTGAATATGAA
    TTACGCTTAACTTCAATGAATAAAAAGTTGAACAATGAAATTGAAACGTTATATATGATG
    TCTAGTACTAATTATTCATTTATAAGTTCAAGTATTGTTAAAGAAGTTGCAGCTTATCGA
    GCAGATATTTCTGAATTCGTTCCACCTTATGTTGAAAAGGCATTGAAGAAGAAATTTAAG
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    483

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0973 [new locus tag: SA_RS05510 ]
  • symbol: CoaD
  • description: phosphopantetheine adenylyltransferase
  • length: 160
  • theoretical pI: 6.67902
  • theoretical MW: 18371
  • GRAVY: -0.245

Function[edit source | edit]

  • reaction:
    EC 2.7.7.3?  ExPASy
    Pantetheine-phosphate adenylyltransferaseATP + pantetheine 4'-phosphate = diphosphate + 3'-dephospho-CoA
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPantothenate and coenzyme Apantetheine-phosphate adenylyltransferase (TIGR01510; EC 2.7.7.3; HMM-score: 207.5)
    cytidyltransferase-like domain (TIGR00125; HMM-score: 57)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPyridine nucleotidesnicotinate (nicotinamide) nucleotide adenylyltransferase (TIGR00482; EC 2.7.7.18; HMM-score: 39.9)
    Genetic information processingProtein fateProtein modification and repair[citrate (pro-3S)-lyase] ligase (TIGR00124; EC 6.2.1.22; HMM-score: 34.1)
    MetabolismEnergy metabolismFermentation[citrate (pro-3S)-lyase] ligase (TIGR00124; EC 6.2.1.22; HMM-score: 34.1)
    nicotinamide-nucleotide adenylyltransferase (TIGR01526; EC 2.7.7.1; HMM-score: 25.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPyridine nucleotidesnicotinamide-nucleotide adenylyltransferase (TIGR01527; EC 2.7.7.1; HMM-score: 23)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, PigmentsCoenzyme ACoenzyme A Biosynthesis Phosphopantetheine adenylyltransferase (EC 2.7.7.3) 
    CBSS-269801.1.peg.1715 Phosphopantetheine adenylyltransferase (EC 2.7.7.3) 
  • PFAM:
    HUP (CL0039) CTP_transf_like; Cytidylyltransferase-like (PF01467; HMM-score: 67.6)
    Citrate_ly_lig; Citrate lyase ligase C-terminal domain (PF08218; HMM-score: 39.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.099
    • Ymax_pos: 70
    • Cmax: 0.108
    • Cmax_pos: 21
    • Smax: 0.108
    • Smax_pos: 70
    • Smean: 0.074
    • D: 0.089
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKEGTFSLEERMDLIEQSVKHLPNVKVHQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMMSSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]