From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003352000
  • symbol?: coaD
  • description?: phosphopantetheine adenylyltransferase

      descriptions from strain specific annotations:

    • phosphopantetheine adenylyltransferase
    • putative phosphopantetheine adenylyltransferase
    • lipopolysaccharide core biosynthesis protein KdtB
    • pantetheine-phosphate adenylyltransferase
  • strand?: +
  • coordinates?: 3718249..3718731
  • synteny block?: BlockID0024360
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1134 (coaD)
    N315:
    SA0973 (coaD)
    NCTC8325:
    Newman:
    NWMN_0988 (coaD)
    USA300_FPR3757:
    04-02981:
    SA2981_1081
    08BA02176:
    C248_1151 (coaD)
    11819-97:
    MS7_1081 (coaD)
    71193:
    ST398NM01_1121
    ECT-R 2:
    ECTR2_979 (coaD)
    ED133:
    SAOV_1066
    ED98:
    SAAV_1091 (coaD)
    HO 5096 0412:
    SAEMRSA15_09540 (coaD)
    JH1:
    SaurJH1_1206 (coaD)
    JH9:
    SaurJH9_1184 (coaD)
    JKD6008:
    SAA6008_01079 (kdtB)
    JKD6159:
    SAA6159_00979 (kdtB)
    LGA251:
    SARLGA251_10370 (coaD)
    M013:
    M013TW_1056
    MRSA252:
    SAR1098 (coaD)
    MSHR1132:
    SAMSHR1132_09710
    MSSA476:
    SAS1059 (coaD)
    Mu3:
    SAHV_1116 (coaD)
    Mu50:
    SAV1125 (coaD)
    MW2:
    MW1007 (coaD)
    RF122:
    SAB0989 (coaD)
    ST398:
    SAPIG1121 (coaD)
    T0131:
    SAT0131_01163
    TCH60:
    HMPREF0772_12108 (coaD)
    TW20:
    SATW20_11190 (coaD)
    USA300_TCH1516:
    USA300HOU_1062 (coaD)
    VC40:
    SAVC_04785 (coaD)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKEGTFSLEERMDLIEQSV
    N315            MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKEGTFSLEERMDLIEQSV
    NCTC8325        MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKEGTFSLEERMDLIEQSV
    Newman          MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKEGTFSLEERMDLIEQSV
    USA300_FPR3757  MEHTIAVIPGSFDPITYGHLDIIERSTDRFDEIHVCVLKNSKKEGTFSLEERMDLIEQSV
                    ************************************************************

    COL             KHLPNVKVHQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMM
    N315            KHLPNVKVHQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMM
    NCTC8325        KHLPNVKVHQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMM
    Newman          KHLPNVKVHQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMM
    USA300_FPR3757  KHLPNVKVHQFSGLLVDYCEQVGAKTIIRGLRAVSDFEYELRLTSMNKKLNNEIETLYMM
                    ************************************************************

    COL             SSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
    N315            SSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
    NCTC8325        SSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
    Newman          SSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
    USA300_FPR3757  SSTNYSFISSSIVKEVAAYRADISEFVPPYVEKALKKKFK
                    ****************************************