From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0998 [new locus tag: SA_RS05655 ]
  • pan locus tag?: SAUPAN003391000
  • symbol: SA0998
  • pan gene symbol?:
  • synonym:
  • product: nucleoside-triphosphatase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0998 [new locus tag: SA_RS05655 ]
  • symbol: SA0998
  • product: nucleoside-triphosphatase
  • replicon: chromosome
  • strand: +
  • coordinates: 1131655..1132242
  • length: 588
  • essential: yes DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAAGAGATTGTTATTGCATCGAATAATCAAGGGAAAATAAATGACTTTAAAGTAATA
    TTTCCAGATTACCACGTAATAGGTATTTCAGAACTAATACCAGATTTTGATGTGGAAGAA
    ACAGGATCAACATTTGAAGAAAATGCTATATTAAAATCAGAAGCTGCTGCAAAAGCATTG
    AATAAAACTGTCATAGCTGATGACAGTGGACTAGAAGTTTTTGCATTAAATGGTGAGCCA
    GGTATATACTCTGCACGTTATGCTGGTGAAAATAAAAGCGATGAAGCAAATATTGAAAAA
    TTATTAAATAAGCTTGGTAATACAACTGATCGTCGTGCGCAATTTGTTTGTGTCATAAGT
    ATGAGTGGCCCTGATATGGAAACAAAAGTATTTAAAGGTACTGTTTCAGGTGAAATTGCA
    GATGGAAAATATGGCGAAAATGGTTTCGGATATGATCCGATATTTTATGTACCGAAATTA
    GATAAAACCATGGCTCAACTTTCAAAAGAACAAAAAGGGCAAATTAGTCATAGACGAAAT
    GCGATTAATTTACTTCAAGCTTTTCTTGAAGGTGAAAAAAATGTCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    588

Protein[edit source | edit]

Protein Data Bank: 4BNQ

General[edit source | edit]

  • locus tag: SA0998 [new locus tag: SA_RS05655 ]
  • symbol: SA0998
  • description: nucleoside-triphosphatase
  • length: 195
  • theoretical pI: 4.63388
  • theoretical MW: 21417
  • GRAVY: -0.36359

Function[edit source | edit]

  • reaction:
    EC 3.6.1.19?  ExPASy
    Nucleoside-triphosphate diphosphataseA nucleoside triphosphate + H2O = a nucleotide + diphosphate
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairnon-canonical purine NTP pyrophosphatase, RdgB/HAM1 family (TIGR00042; EC 3.6.1.-; HMM-score: 203.2)
  • TheSEED:  
    Nucleosides and NucleotidesDetoxificationHousecleaning nucleoside triphosphate pyrophosphatases Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15) 
    Stress ResponseHeat shockHeat shock dnaK gene cluster extended Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15) 
  • PFAM:
    Maf (CL0269) Ham1p_like; Ham1 family (PF01725; HMM-score: 188.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+, Mn2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.104
    • Ymax_pos: 67
    • Cmax: 0.122
    • Cmax_pos: 67
    • Smax: 0.12
    • Smax_pos: 38
    • Smean: 0.081
    • D: 0.095
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKEIVIASNNQGKINDFKVIFPDYHVIGISELIPDFDVEETGSTFEENAILKSEAAAKALNKTVIADDSGLEVFALNGEPGIYSARYAGENKSDEANIEKLLNKLGNTTDRRAQFVCVISMSGPDMETKVFKGTVSGEIADGKYGENGFGYDPIFYVPKLDKTMAQLSKEQKGQISHRRNAINLLQAFLEGEKNV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J. Microbiol. Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)