From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1000 [new locus tag: SA_RS05670 ]
  • pan locus tag?: SAUPAN003394000
  • symbol: SA1000
  • pan gene symbol?: ecb
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1000 [new locus tag: SA_RS05670 ]
  • symbol: SA1000
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1133227..1133556
  • length: 330
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGAAAAAGAATTTTATTGGGAAATCAATTTTAAGCATAGCTGCTATTAGTTTAACGGTA
    TCAACGTTTGCCGGTGAATCTCATGCACAAACTAAAAACGTTGAAGCTGCTAAAAAATAT
    GATCAGTATCAAACAAACTTTAAAAAACAAGTAAATAAAAAAGTTGTGGATGCACAAAAA
    GCTGTAAACTTGTTCAAACGTACAAGAACTGTTGCAACACACCGTAAAGCACAAAGAGCT
    GTTAATTTAATTCATTTCCAACACAGCTATGAAAAGAAAAAATTACAAAGACAAATCGAT
    CTAGTTTTAAAATATAATACTTTAAAATAA
    60
    120
    180
    240
    300
    330

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1000 [new locus tag: SA_RS05670 ]
  • symbol: SA1000
  • description: hypothetical protein
  • length: 109
  • theoretical pI: 11.1179
  • theoretical MW: 12562.5
  • GRAVY: -0.623853

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Virulence, Disease and DefenseAdhesionAdhesins in Staphylococcus Hypothetical protein, similarity with fibrinogen-binding protein Efb 
  • PFAM:
    no clan definedefb-c; Extracellular fibrinogen binding protein C terminal (PF12199; HMM-score: 128.4)
    DUF3546; Domain of unknown function (DUF3546) (PF12066; HMM-score: 18.4)
    IDEAL; IDEAL domain (PF08858; HMM-score: 13.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.09
    • Cellwall Score: 0.18
    • Extracellular Score: 9.73
    • Internal Helices: 0
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: -0.17
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: -2
    • Predicted Cleavage Site: ESHAQTKN
  • SignalP: Signal peptide length 30 aa
    • Ymax: 0.798
    • Ymax_pos: 30
    • Cmax: 0.787
    • Cmax_pos: 30
    • Smax: 0.939
    • Smax_pos: 14
    • Smean: 0.845
    • D: 0.816
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKNFIGKSILSIAAISLTVSTFAGESHAQTKNVEAAKKYDQYQTNFKKQVNKKVVDAQKAVNLFKRTRTVATHRKAQRAVNLIHFQHSYEKKKLQRQIDLVLKYNTLK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SaeR
    SaeR (TF) important in Virulence  RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Ilse Jongerius, Jörg Köhl, Manoj K Pandey, Maartje Ruyken, Kok P M van Kessel, Jos A G van Strijp, Suzan H M Rooijakkers
Staphylococcal complement evasion by various convertase-blocking molecules.
J. Exp. Med.: 2007, 204(10);2461-71
[PubMed:17893203] [WorldCat.org] [DOI] (P p)