From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003394000
  • symbol?: ecb
  • description?: fibrinogen binding-related protein

      descriptions from strain specific annotations:

    • fibrinogen binding-related protein
    • fibrinogen-binding protein
    • fibrinogen binding-like protein
    • fibrinogen-binding protein-like protein
    • extracellular fibrinogen binding protein
    • Fibrinogen-binding protein-related
    • exported protein
  • strand?: +
  • coordinates?: 3755250..3755592
  • synteny block?: BlockID0024770
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1110 (efb)
    08BA02176:
    C248_1183
    11819-97:
    MS7_1110
    71193:
    ST398NM01_1150
    ECT-R 2:
    ECTR2_1008
    ED133:
    SAOV_1151
    ED98:
    SAAV_1122
    HO 5096 0412:
    SAEMRSA15_09840
    JH1:
    SaurJH1_1235
    JH9:
    SaurJH9_1212
    JKD6008:
    SAA6008_01107 (ecb)
    JKD6159:
    SAA6159_01007 (ecb)
    LGA251:
    SARLGA251_10650 (ecb)
    M013:
    M013TW_1086
    MRSA252:
    SAR1127
    MSHR1132:
    SAMSHR1132_09990
    MSSA476:
    SAS1088
    Mu3:
    SAHV_1145
    Mu50:
    SAV1155
    MW2:
    MW1037
    RF122:
    SAB1018
    ST398:
    SAPIG1150
    T0131:
    SAT0131_01197 (infA)
    TCH60:
    HMPREF0772_12079
    TW20:
    SATW20_11470 (ecb)
    USA300_TCH1516:
    USA300HOU_1090
    VC40:
    SAVC_04930

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKNFIGKSILSIAAISLTVSTFAGESHAQTKNVEAAKKYDQYQTNFKKQVNKKVVDAQK
    N315            MKKNFIGKSILSIAAISLTVSTFAGESHAQTKNVEAAKKYDQYQTNFKKQVNKKVVDAQK
    NCTC8325        MKKNFIGKSILSIAAISLTVSTFAGESHAQTKNVEAAKKYDQYQTNFKKQVNKKVVDAQK
    Newman          MKKNFIGKSILSIAAISLTVSTFAGESHAQTKNVEAAKKYDQYQTNFKKQVNKKVVDAQK
    USA300_FPR3757  MKKNFIGKSILSIAAISLTVSTFAGESHAQTKNVEAAKKYDQYQTNFKKQVNKKVVDAQK
                    ************************************************************

    COL             AVNFFKRTRTVATHRKAQRAVNLIHFQHSYEKKKLQRQIDLVLKYNTLK
    N315            AVNLFKRTRTVATHRKAQRAVNLIHFQHSYEKKKLQRQIDLVLKYNTLK
    NCTC8325        AVNFFKRTRTVATHRKAQRAVNLIHFQHSYEKKKLQRQIDLVLKYNTLK
    Newman          AVNFFKRTRTVATHRKAQRAVNLIHFQHSYEKKKLQRQIDLVLKYNTLK
    USA300_FPR3757  AVNFFKRTRTVATHRKAQRAVNLIHFQHSYEKKKLQRQIDLVLKYNTLK
                    ***:*********************************************