From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1185 [new locus tag: SA_RS06735 ]
  • pan locus tag?: SAUPAN003738000
  • symbol: SA1185
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1185 [new locus tag: SA_RS06735 ]
  • symbol: SA1185
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1352174..1352641
  • length: 468
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGATATATAGTATTACAGAAATAGAAGCGCGTTATGCTGAAACTGATAAGATGGGTGTA
    ATTTATCACGGGAATTATGCAACTTGGTTTGAAGTTGCGCGGTTGGATTATATATCGAAG
    TTAGGTTTTAGTTATGCTGATATGGAAAAACAAGGAATCATTTCACCTGTGACTGACCTC
    AATGTCAATTATAAAAAGTCTATTTTTTATCCAGAAAAAGTTAAAGTTAAAACTTGGGTT
    GAAAAATATTCGAGATTACGTTCAGTGTATAAATATGAGATTTTTAATGAAAAAGGTGAA
    CTTGCAACTACAGGTTCCACAGAATTGATTTGCATTAAAGAAGATACTTTTAAGCCTATA
    CGGTTGGATCGTTATTTCCCAGATTGGCATGAAGCTTATAGTAAAGTGCAAACGCTCAAT
    AATGAAGGGAAAACAGTAGAGATAATGGATGGTATTGATTCTTTATAA
    60
    120
    180
    240
    300
    360
    420
    468

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1185 [new locus tag: SA_RS06735 ]
  • symbol: SA1185
  • description: hypothetical protein
  • length: 155
  • theoretical pI: 5.34661
  • theoretical MW: 18175.6
  • GRAVY: -0.452258

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionGeneralacyl-CoA thioester hydrolase, YbgC/YbaW family (TIGR00051; HMM-score: 101.2)
    tol-pal system-associated acyl-CoA thioesterase (TIGR02799; EC 3.1.2.-; HMM-score: 61.1)
    uncharacterized domain 1 (TIGR00369; HMM-score: 15.8)
    superoxide dismutase, Ni (TIGR02753; EC 1.15.1.1; HMM-score: 12.9)
  • TheSEED:  
    4-hydroxybenzoyl-CoA thioesterase family active site 
  • PFAM:
    HotDog (CL0050) 4HBT; Thioesterase superfamily (PF03061; HMM-score: 65.5)
    4HBT_2; Thioesterase-like superfamily (PF13279; HMM-score: 37.1)
    Acyl-ACP_TE; Acyl-ACP thioesterase (PF01643; HMM-score: 29.2)
    no clan definedCreD; Inner membrane protein CreD (PF06123; HMM-score: 11.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.094
    • Ymax_pos: 56
    • Cmax: 0.142
    • Cmax_pos: 47
    • Smax: 0.103
    • Smax_pos: 48
    • Smean: 0.059
    • D: 0.081
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIYSITEIEARYAETDKMGVIYHGNYATWFEVARLDYISKLGFSYADMEKQGIISPVTDLNVNYKKSIFYPEKVKVKTWVEKYSRLRSVYKYEIFNEKGELATTGSTELICIKEDTFKPIRLDRYFPDWHEAYSKVQTLNNEGKTVEIMDGIDSL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]