From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1194 [new locus tag: SA_RS06790 ]
  • pan locus tag?: SAUPAN003750000
  • symbol: msrA
  • pan gene symbol?: msrA2
  • synonym:
  • product: methionine sulfoxide reductase A

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1194 [new locus tag: SA_RS06790 ]
  • symbol: msrA
  • product: methionine sulfoxide reductase A
  • replicon: chromosome
  • strand: -
  • coordinates: 1366337..1366846
  • length: 510
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAATATTAATACAGCTTATTTTGCCGGAGGTTGCTTTTGGTGTATGACGAAACCATTT
    GACACCTTTGACGGCATAGAAAAAGTAACTTCTGGATATATGGGCGGACATATTGAAAAT
    CCTACTTACGAACAAGTAAAATCAGGTACGAGTGGTCATTTAGAAACTGTTGAAATTCAA
    TATGATGTTGCATTATTCTCATACAATAAGTTATTAGAAATATTTTTCTCAGTCATTGAC
    CCATTAGATACAGGTGGTCAATATCAAGACCGTGGTCCTCAATATCAAACAGCTATTTTC
    TACACTAATGATCATCAAAAAGAACTCGCTGAGACATATATCGAGCAGCTTAAAAATACG
    ATTAATGCTGATAAGGCAATTGCAACAAAAATATTACCAGCGTCACAATTTTACAAAGCC
    GAAGACTATCACCAAGATTTTTATAAGAAAAATCCAGAGCGCTATGCAGAAGAACAAAAA
    ATACGCCAAGAATACAAAAATAAGCAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    510

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1194 [new locus tag: SA_RS06790 ]
  • symbol: MsrA
  • description: methionine sulfoxide reductase A
  • length: 169
  • theoretical pI: 4.86349
  • theoretical MW: 19610.7
  • GRAVY: -0.739645

Function[edit source | edit]

  • reaction:
    EC 1.8.4.11?  ExPASy
    Peptide-methionine (S)-S-oxide reductasePeptide-L-methionine + thioredoxin disulfide + H2O = peptide-L-methionine (S)-S-oxide + thioredoxinL-methionine + thioredoxin disulfide + H2O = L-methionine (S)-S-oxide + thioredoxin
  • TIGRFAM:
    Cellular processesCellular processesAdaptations to atypical conditionspeptide-methionine (S)-S-oxide reductase (TIGR00401; EC 1.8.4.11; HMM-score: 188.7)
    Genetic information processingProtein fateProtein modification and repairpeptide-methionine (S)-S-oxide reductase (TIGR00401; EC 1.8.4.11; HMM-score: 188.7)
  • TheSEED:  
    Peptide methionine sulfoxide reductase Peptide-methionine (S)-S-oxide reductase MsrA (EC 1.8.4.11) 
  • PFAM:
    no clan definedPMSR; Peptide methionine sulfoxide reductase (PF01625; HMM-score: 198.7)
    RCDG1; Renal cancer differentiation gene 1 protein (PF15725; HMM-score: 14.4)
    DUF4298; Domain of unknown function (DUF4298) (PF14131; HMM-score: 13)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.141
    • Ymax_pos: 26
    • Cmax: 0.135
    • Cmax_pos: 26
    • Smax: 0.259
    • Smax_pos: 4
    • Smean: 0.156
    • D: 0.147
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNINTAYFAGGCFWCMTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQYDVALFSYNKLLEIFFSVIDPLDTGGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNTINADKAIATKILPASQFYKAEDYHQDFYKKNPERYAEEQKIRQEYKNKQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • msrA no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]