From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003750000
  • symbol?: msrA2
  • description?: methionine sulfoxide reductase A

      descriptions from strain specific annotations:

    • methionine sulfoxide reductase A
    • methionine-S-sulfoxide reductase
    • Peptide methionine sulfoxide reductase msrA 1
    • peptide methionine sulfoxide reductase I
    • peptide methionine sulfoxide reductase MsrA
    • peptide methionine sulfoxide reductase 1
    • peptide-methionine-(S)-S-oxide reductase
  • strand?: -
  • coordinates?: 4051595..4052072
  • synteny block?: BlockID0028130
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1397 (msrA)
    N315:
    SA1194 (msrA)
    NCTC8325:
    Newman:
    NWMN_1273 (msrA)
    USA300_FPR3757:
    04-02981:
    SA2981_1315 (msrA)
    08BA02176:
    C248_1398 (msrA1)
    11819-97:
    MS7_1318 (msrA1)
    71193:
    ST398NM01_1362
    ECT-R 2:
    ECTR2_1218 (msrA)
    ED133:
    SAOV_1372c
    ED98:
    SAAV_1341 (msrA)
    HO 5096 0412:
    SAEMRSA15_12090 (msrA1)
    JH1:
    SaurJH1_1450
    JH9:
    SaurJH9_1422
    JKD6008:
    SAA6008_01326
    JKD6159:
    SAA6159_01226
    LGA251:
    SARLGA251_12700 (msrA2)
    M013:
    M013TW_1307
    MRSA252:
    SAR1373 (msrA1)
    MSHR1132:
    SAMSHR1132_12040
    MSSA476:
    SAS1301
    Mu3:
    SAHV_1349 (msrA2)
    Mu50:
    SAV1361 (msrA)
    MW2:
    MW1248 (msrA)
    RF122:
    SAB1217c (msrA1)
    ST398:
    SAPIG1362 (msrA)
    T0131:
    SAT0131_01433
    TCH60:
    HMPREF0772_11848 (msrA3)
    TW20:
    SATW20_13610 (msrA2)
    USA300_TCH1516:
    USA300HOU_1295 (msrA1)
    VC40:
    SAVC_06050

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNINTAYFAGGCFWCMTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQ
    N315            MNINTAYFAGGCFWCMTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQ
    NCTC8325        MNINTAYFAGGCFWCMTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQ
    Newman          MNINTAYFAGGCFWCMTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQ
    USA300_FPR3757  MNINTAYFAGGCFWCMTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQ
                    ************************************************************

    COL             YDVALFSYNKLLEIFFSVIDPLDTGGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNT
    N315            YDVALFSYNKLLEIFFSVIDPLDTGGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNT
    NCTC8325        YDVALFSYNKLLEIFFSVIDPLDTGGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNT
    Newman          YDVALFSYNKLLEIFFSVIDPLDTGGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNT
    USA300_FPR3757  YDVALFSYNKLLEIFFSVIDPLDTGGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNT
                    ************************************************************

    COL             INADKAIATKILPASQFYKAEDYHQDFYKKNPERYAEEQKIRQEYKNKQ
    N315            INADKAIATKILPASQFYKAEDYHQDFYKKNPERYAEEQKIRQEYKNKQ
    NCTC8325        INADKAIATKILPASQFYKAEDYHQDFYKKNPERYAEEQKIRQEYKNKQ
    Newman          INADKAIATKILPASQFYKAEDYHQDFYKKNPERYAEEQKIRQEYKNKQ
    USA300_FPR3757  INADKAIATKILPASQFYKAEDYHQDFYKKNPERYAEEQKIRQEYKNKQ
                    *************************************************