From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003854000
  • symbol?: msrB
  • description?: methionine sulfoxide reductase B

      descriptions from strain specific annotations:

    • methionine sulfoxide reductase B
    • Peptide methionine sulfoxide reductase MsrB
    • methionine-R-sulfoxide reductase
  • strand?: -
  • coordinates?: 4137783..4138211
  • synteny block?: BlockID0029100
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1334 (msrB)
    USA300_FPR3757:
    04-02981:
    SA2981_1377 (msrB)
    08BA02176:
    C248_1463
    11819-97:
    MS7_1379 (msrB)
    71193:
    ST398NM01_1424
    ECT-R 2:
    ECTR2_1279 (msrB)
    ED133:
    SAOV_1432c
    ED98:
    SAAV_1406 (msrB)
    HO 5096 0412:
    SAEMRSA15_12860
    JH1:
    SaurJH1_1512
    JH9:
    SaurJH9_1483
    JKD6008:
    SAA6008_01391 (msrB)
    JKD6159:
    SAA6159_01290 (msrB)
    LGA251:
    SARLGA251_13390 (msrB)
    M013:
    M013TW_1369
    MRSA252:
    SAR1436
    MSHR1132:
    SAMSHR1132_12650
    MSSA476:
    SAS1366
    Mu3:
    SAHV_1411
    Mu50:
    SAV1423
    MW2:
    MW1313
    RF122:
    SAB1278c
    ST398:
    SAPIG1424 (msrB)
    T0131:
    SAT0131_01503
    TCH60:
    HMPREF0772_11783 (msrB)
    TW20:
    SATW20_14240 (msrB)
    USA300_TCH1516:
    USA300HOU_1360 (msrB)
    VC40:
    SAVC_06365

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MLKKDKSELTDIEYIVTQENGTEPPFMNEYWNHFAKGIYVDKISGKPLFTSEEKFHSECG
    NCTC8325        MLKKDKSELTDIEYIVTQENGTEPPFMNEYWNHFAKGIYVDKISGKPLFTSEEKFHSECG
    Newman          MLKKDKSELTDIEYIVTQENGTEPPFMNEYWNHFAKGIYVDKISGKPLFTSEEKFHSECG
    USA300_FPR3757  MLKKDKSELTDIEYIVTQENGTEPPFMNEYWNHFAKGIYVDKISGKPLFTSEEKFHSECG
                    ************************************************************

    N315            WPSFSKALDDDEIIELVDKSFGMVRTEVRSEESNSHLGHVFNDGPKESGGLRYCINSAAI
    NCTC8325        WPSFSKALDDDEIIELVDKSFGMLRTEVRSEESNSHLGHVFNDGPKESGGLRYCINSAAI
    Newman          WPSFSKALDDDEIIELVDKSFGMLRTEVRSEESNSHLGHVFNDGPKESGGLRYCINSAAI
    USA300_FPR3757  WPSFSKALDDDEIIELVDKSFGMLRTEVRSEESNSHLGHVFNDGPKESGGLRYCINSAAI
                    ***********************:************************************

    N315            QFIPYEKLEELGYGDLISHFDK
    NCTC8325        QFIPYEKLEELGYGDLISHFDK
    Newman          QFIPYEKLEELGYGDLISHFDK
    USA300_FPR3757  QFIPYEKLEELGYGDLISHFDK
                    **********************