From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1315 [new locus tag: SA_RS07455 ]
  • pan locus tag?: SAUPAN003949000
  • symbol: fer
  • pan gene symbol?: fer
  • synonym:
  • product: ferredoxin

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1315 [new locus tag: SA_RS07455 ]
  • symbol: fer
  • product: ferredoxin
  • replicon: chromosome
  • strand: +
  • coordinates: 1522837..1523085
  • length: 249
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    TTGGCAAAATATACAATCGTTGATATGGATACTTGTATTGCATGTGGTGCATGCGGTGCA
    GCAGCGCCAGATATATATGATTACGACGACGAAGGTATTGCTTTCGTAATCCTTGACGAT
    AACCAAGGTACTGCAGAAGTACCTGAGGAATTATATGAAGATATGGAAGATGCAATTGAT
    GGATGCCCTACAGATTCTATTAAAATTGCAGACGAATCATTTGATGGGGACGCTTTAAAA
    TTTGAATAA
    60
    120
    180
    240
    249

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1315 [new locus tag: SA_RS07455 ]
  • symbol: Fer
  • description: ferredoxin
  • length: 82
  • theoretical pI: 3.24434
  • theoretical MW: 8840.62
  • GRAVY: -0.147561

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismElectron transportNADH-quinone oxidoreductase, chain I (TIGR01971; HMM-score: 14.6)
    MetabolismCentral intermediary metabolismSulfur metabolismsulfite reductase, dissimilatory-type beta subunit (TIGR02066; EC 1.8.99.3; HMM-score: 13.7)
    MetabolismEnergy metabolismElectron transportcytochrome c nitrite reductase, Fe-S protein (TIGR03149; EC 1.7.2.2; HMM-score: 12.5)
    MetabolismEnergy metabolismAnaerobicformate dehydrogenase, beta subunit (TIGR01582; EC 1.2.1.2; HMM-score: 11.6)
    MetabolismEnergy metabolismElectron transportformate dehydrogenase, beta subunit (TIGR01582; EC 1.2.1.2; HMM-score: 11.6)
    [FeFe] hydrogenase, group B1/B3 (TIGR04105; EC 1.12.-.-; HMM-score: 9.8)
  • TheSEED:  
    RespirationRespiration - no subcategorySoluble cytochromes and functionally related electron carriers Ferredoxin 
  • PFAM:
    4Fe-4S (CL0344) Fer4_13; 4Fe-4S single cluster domain of Ferredoxin I (PF13370; HMM-score: 80)
    Fer4_15; 4Fe-4S single cluster domain (PF13459; HMM-score: 52.9)
    Fer4; 4Fe-4S binding domain (PF00037; HMM-score: 20.9)
    Fer4_2; 4Fe-4S binding domain (PF12797; HMM-score: 15.7)
    Fer4_10; 4Fe-4S dicluster domain (PF13237; HMM-score: 15.6)
    Fer4_19; Divergent 4Fe-4S mono-cluster (PF06902; HMM-score: 15)
    Fer4_7; 4Fe-4S dicluster domain (PF12838; HMM-score: 14.9)
    Fer4_6; 4Fe-4S binding domain (PF12837; HMM-score: 13.8)
    Fer4_21; 4Fe-4S dicluster domain (PF14697; HMM-score: 13.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.141
    • Ymax_pos: 23
    • Cmax: 0.154
    • Cmax_pos: 23
    • Smax: 0.296
    • Smax_pos: 7
    • Smean: 0.156
    • D: 0.146
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 15927065 NCBI
  • RefSeq: NP_374598 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MAKYTIVDMDTCIACGACGAAAPDIYDYDDEGIAFVILDDNQGTAEVPEELYEDMEDAIDGCPTDSIKIADESFDGDALKFE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • fer no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]