From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1333 [new locus tag: SA_RS07555 ]
  • pan locus tag?: SAUPAN004035000
  • symbol: SA1333
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1333 [new locus tag: SA_RS07555 ]
  • symbol: SA1333
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1539603..1540358
  • length: 756
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAAAGGACAACATTTTATAGTGACTGGTGGTACGAGTGGTTTAGGTTTATCGATTGTC
    CGAAAGTTACTAGAAAATAAAGTGCATGTAACGTTGTTGGTGCGTGATGTTGATAAAGCA
    ACTAGAATCTTTGAACAAGAATTGGGGAAAACTATAAATGTTATTCCTTGTGACTTAAAT
    GATTTGAAGTCGATACAGGCACTGCAATTTGAAGACAATACATCATTCGATGGATTCATT
    TATAGTGCAGGTTTAGGTTATTTCAAATCTATTTCAGACCATAGTTTTTCAGAAATGATT
    GAAACGTATCAGCTTAATTTAATTAGTTTTAATGTTTTATATACTGTGTTGAGACCATAT
    TTAACATCTAACGCACATATTGTAGGTATTTCAAGTCAAGCTGCATTTTCCACACAAGCA
    AATGCTGCACATTATGGGGCATCGAAAGCAGGGTTTTATGCATTAATGAATGCTTTAAGA
    CTAGAGTCACCAAACTTACATATCATGACAGTTAATGTTGGCCCGATTGATACACCTTTT
    CATCAAAAAGCCGACCCATCAATGAAGTATGCTAAAAAGATGGGGGAAATTATGCTTGAT
    GCTAATCAGCTTGCAGAAGATATCATTTATGGCATTAAAACAAAACAATTGGAAATTAAT
    CGGCCTAAATGGATGCATCATGCGTTGAAAATGTATCAAATTGCGCCTAGATTTTTTGAA
    CGATGTTTCCCTAAATTATTTAAAAATAAAGCATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    756

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1333 [new locus tag: SA_RS07555 ]
  • symbol: SA1333
  • description: hypothetical protein
  • length: 251
  • theoretical pI: 9.39542
  • theoretical MW: 28270.5
  • GRAVY: -0.0992032

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (TIGR04316; EC 1.3.1.28; HMM-score: 50.3)
    MetabolismFatty acid and phospholipid metabolismBiosynthesis3-oxoacyl-[acyl-carrier-protein] reductase (TIGR01830; EC 1.1.1.100; HMM-score: 48.3)
    acetoacetyl-CoA reductase (TIGR01829; EC 1.1.1.36; HMM-score: 39.1)
    sepiapterin reductase (TIGR01500; EC 1.1.1.153; HMM-score: 38.2)
    3-hydroxybutyrate dehydrogenase (TIGR01963; HMM-score: 36.4)
    Unknown functionEnzymes of unknown specificitySDR family mycofactocin-dependent oxidoreductase (TIGR03971; EC 1.1.99.-; HMM-score: 36.4)
    2-hydroxycyclohexanecarboxyl-CoA dehydrogenase (TIGR03206; EC 1.1.1.-; HMM-score: 35.3)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisputative 3-oxoacyl-(acyl-carrier-protein) reductase (TIGR01831; HMM-score: 31.2)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharides2-deoxy-D-gluconate 3-dehydrogenase (TIGR01832; EC 1.1.1.125; HMM-score: 30.7)
    MetabolismEnergy metabolismFermentationacetoin reductases (TIGR02415; EC 1.1.1.-; HMM-score: 30.7)
    cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (TIGR03325; EC 1.3.1.56; HMM-score: 25.3)
    rhamnulose-1-phosphate aldolase/alcohol dehydrogenase (TIGR02632; EC 1.1.1.1,4.1.2.19; HMM-score: 23)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphylllight-dependent protochlorophyllide reductase (TIGR01289; EC 1.3.1.33; HMM-score: 20.3)
    hopanoid-associated sugar epimerase (TIGR03466; HMM-score: 13.7)
    Unknown functionEnzymes of unknown specificitySDR family mycofactocin-dependent oxidoreductase (TIGR04504; EC 1.1.99.-; HMM-score: 13.5)
    polyketide-type polyunsaturated fatty acid synthase PfaA (TIGR02813; HMM-score: 11.7)
  • TheSEED:  
    Oxidoreductase, short-chain dehydrogenase/reductase family 
  • PFAM:
    NADP_Rossmann (CL0063) adh_short; short chain dehydrogenase (PF00106; HMM-score: 93.5)
    adh_short_C2; Enoyl-(Acyl carrier protein) reductase (PF13561; HMM-score: 62.5)
    KR; KR domain (PF08659; HMM-score: 41.4)
    NAD_binding_10; NAD(P)H-binding (PF13460; HMM-score: 25.9)
    Epimerase; NAD dependent epimerase/dehydratase family (PF01370; HMM-score: 23.8)
    NmrA; NmrA-like family (PF05368; HMM-score: 18.6)
    3Beta_HSD; 3-beta hydroxysteroid dehydrogenase/isomerase family (PF01073; HMM-score: 16.8)
    NAD_binding_4; Male sterility protein (PF07993; HMM-score: 16.7)
    Sacchrp_dh_NADP; Saccharopine dehydrogenase NADP binding domain (PF03435; HMM-score: 13.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.129
    • Ymax_pos: 11
    • Cmax: 0.108
    • Cmax_pos: 33
    • Smax: 0.217
    • Smax_pos: 1
    • Smean: 0.155
    • D: 0.139
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKGQHFIVTGGTSGLGLSIVRKLLENKVHVTLLVRDVDKATRIFEQELGKTINVIPCDLNDLKSIQALQFEDNTSFDGFIYSAGLGYFKSISDHSFSEMIETYQLNLISFNVLYTVLRPYLTSNAHIVGISSQAAFSTQANAAHYGASKAGFYALMNALRLESPNLHIMTVNVGPIDTPFHQKADPSMKYAKKMGEIMLDANQLAEDIIYGIKTKQLEINRPKWMHHALKMYQIAPRFFERCFPKLFKNKA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]