From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004035000
  • symbol?:
  • description?: SDR family oxidoreductase

      descriptions from strain specific annotations:

    • SDR family oxidoreductase
    • short chain dehydrogenase/reductase oxidoreductase
    • short-chain oxidoreductase family protein
    • short chain dehydrogenase/reductase family oxidoreductase
    • oxidoreductase, short-chain dehydrogenase/reductase family
    • HetN
    • oxidoreductase
    • putative short chain dehydrogenase
    • short-chain dehydrogenase/reductase SDR
    • short chain dehydrogenase family protein
  • strand?: -
  • coordinates?: 4323575..4324330
  • synteny block?: BlockID0030720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1459
    08BA02176:
    C248_1542
    11819-97:
    MS7_1519
    71193:
    ST398NM01_1568
    ECT-R 2:
    ECTR2_1353
    ED133:
    SAOV_1504
    ED98:
    SAAV_1492
    HO 5096 0412:
    SAEMRSA15_14240
    JH1:
    SaurJH1_1590
    JH9:
    SaurJH9_1559
    JKD6008:
    SAA6008_01471
    JKD6159:
    SAA6159_01431
    LGA251:
    SARLGA251_14100
    M013:
    M013TW_1516
    MRSA252:
    SAR1578
    MSHR1132:
    SAMSHR1132_13410
    MSSA476:
    SAS1442
    Mu3:
    SAHV_1490
    Mu50:
    SAV1502
    MW2:
    MW1456
    RF122:
    SAB1363c
    ST398:
    SAPIG1568
    T0131:
    SAT0131_01595
    TCH60:
    HMPREF0772_11639
    TW20:
    SATW20_15000
    USA300_TCH1516:
    USA300HOU_1503
    VC40:
    SAVC_06760

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKGQHFIVTGGTSGLGLSIVRKLLENKVHVTLLVRDVDKATRIFEQELGKTINVIPCDLN
    N315            MKGQHFIVTGGTSGLGLSIVRKLLENKVHVTLLVRDVDKATRIFEQELGKTINVIPCDLN
    NCTC8325        MKGQHFIVTGGTSGLGLSIVRKLLENKVHVTLLVRDVDKATRIFEQELGKTINVIPCDLN
    Newman          MKGQHFIVTGGTSGLGLSIVRKLLENKVHVTLLVRDVDKATRIFEQELGKTINVIPCDLN
    USA300_FPR3757  MKGQHFIVTGGTSGLGLSIVRKLLENKVHVTLLVRDVDKATRIFEQELGKTINVIPCDLN
                    ************************************************************

    COL             DLKSIQALQFEDNTSFDGFIYSAGLGYFKSISDHSFSEMIETYQLNLISFNVLYTVLRPY
    N315            DLKSIQALQFEDNTSFDGFIYSAGLGYFKSISDHSFSEMIETYQLNLISFNVLYTVLRPY
    NCTC8325        DLKSIQALQFEDNTSFDGFIYSAGLGYFKSISDHSFSEMIETYQLNLISFNVLYTVLRPY
    Newman          DLKSIQALQFEDNTSFDGFIYSAGLGYFKSISDHSFSEMIETYQLNLISFNVLYTVLRPY
    USA300_FPR3757  DLKSIQALQFEDNTSFDGFIYSAGLGYFKSISDHSFSEMIETYQLNLISFNVLYTVLRPY
                    ************************************************************

    COL             LTSNAHIVGISSQAAFSTQANAAHYGASKAGFYALMNALRLESPNLHIMTVNVGPIDTPF
    N315            LTSNAHIVGISSQAAFSTQANAAHYGASKAGFYALMNALRLESPNLHIMTVNVGPIDTPF
    NCTC8325        LTSNAHIVGISSQAAFSTQANAAHYGASKAGFYALMNALRLESPNLHIMTVNVGPIDTPF
    Newman          LTSNAHIVGISSQAAFSTQANAAHYGASKAGFYALMNALRLESPNLHIMTVNVGPIDTPF
    USA300_FPR3757  LTSNAHIVGISSQAAFSTQANAAHYGASKAGFYALMNALRLESPNLHIMTVNVGPIDTPF
                    ************************************************************

    COL             HQKADPSMKYAKKMGEIMLDANQLAEDIIYGIKTKQLEINRPKWMHHALKMYQIAPRFFE
    N315            HQKADPSMKYAKKMGEIMLDANQLAEDIIYGIKTKQLEINRPKWMHHALKMYQIAPRFFE
    NCTC8325        HQKADPSMKYAKKMGEIMLDANQLAEDIIYGIKTKQLEINRPKWMHHALKMYQIAPRFFE
    Newman          HQKADPSMKYAKKMGEIMLDANQLAEDIIYGIKTKQLEINRPKWMHHALKMYQIAPRFFE
    USA300_FPR3757  HQKADPSMKYAKKMGEIMLDANQLAEDIIYGIKTKQLEINRPKWMHHALKMYQIAPRFFE
                    ************************************************************

    COL             RCFPKLFKNKA
    N315            RCFPKLFKNKA
    NCTC8325        RCFPKLFKNKA
    Newman          RCFPKLFKNKA
    USA300_FPR3757  RCFPKLFKNKA
                    ***********