From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1437 [new locus tag: SA_RS08105 ]
  • pan locus tag?: SAUPAN004205000
  • symbol: SA1437
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1437 [new locus tag: SA_RS08105 ]
  • symbol: SA1437
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1640120..1640854
  • length: 735
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    GTGGATGTAAGATTTATTAACGAGCAGACAATTATGATTTATTTTGAAAATAAAATATCC
    GAAGAGACATATCGTAATGTCACAGCAATGGTACGGTGGATACGAGAAAAAGAAATATTA
    GAAATTCAAGATATTGTCCCTTCGTATCGAGCAGTTCTAATATATTTTGATGAACAAGCT
    ATAACATCTTCTAAATTAATTGAAAATTTAGAACTTAACAAATTTAATGAAAAAAATGTT
    CATGCTGTGAATCAAACCAATCGTATTATTAAAATACCTGTTCAATATGGTGGTACATAT
    GGACCAGATATTGAAGAAGTAGCAAAGCATAATCGAATAACTGTTGAGCAAGTTATTGAA
    AAACATACAAGTAAACCTTATTTAATATATATGCTAGGATTTATGCCAGGATTTCCATAC
    TTAGGCGGACTTGATGAACAACTACATACACCTAGACGTAATCAGCCAAGGTTAAAAATT
    CATGCAGGTTCTGTAGGTATTGCGAATAATCAAACAGGACTATATCCATCAGATTCTCCT
    GGCGGATGGCAAATTATTGGACGCACACCGTTAAAAGTATTTAGCAGCGAGCGTGAACCA
    ATGTCAATGTACGAAGCAGGAGAATGGATACAATTTTATGCAATAGATGAACAGAAATTT
    ATACAAATCGAAAGAGATATATCAGATGGCAACTTTAATGTTGATGACTGGGTGGTGATT
    GAAAATGTCAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    735

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1437 [new locus tag: SA_RS08105 ]
  • symbol: SA1437
  • description: hypothetical protein
  • length: 244
  • theoretical pI: 4.90822
  • theoretical MW: 28349
  • GRAVY: -0.420902

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Hypothetical proteinsConservedsensor histidine kinase inhibitor, KipI family (TIGR00370; HMM-score: 201.6)
    MetabolismCentral intermediary metabolismNitrogen metabolismurea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 48.6)
  • TheSEED:  
    Allophanate hydrolase 2 and Biotin carboxylase cluster Allophanate hydrolase 2 subunit 1 (EC 3.5.1.54) 
    EC699-706 Allophanate hydrolase 2 subunit 1 (EC 3.5.1.54) 
  • PFAM:
    Cyclophil-like (CL0475) CT_C_D; Carboxyltransferase domain, subdomain C and D (PF02682; HMM-score: 242)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.092
    • Ymax_pos: 70
    • Cmax: 0.106
    • Cmax_pos: 22
    • Smax: 0.098
    • Smax_pos: 69
    • Smean: 0.062
    • D: 0.081
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MDVRFINEQTIMIYFENKISEETYRNVTAMVRWIREKEILEIQDIVPSYRAVLIYFDEQAITSSKLIENLELNKFNEKNVHAVNQTNRIIKIPVQYGGTYGPDIEEVAKHNRITVEQVIEKHTSKPYLIYMLGFMPGFPYLGGLDEQLHTPRRNQPRLKIHAGSVGIANNQTGLYPSDSPGGWQIIGRTPLKVFSSEREPMSMYEAGEWIQFYAIDEQKFIQIERDISDGNFNVDDWVVIENVN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CcpA
    CcpA (TF) important in Carbon catabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]