From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1439 [new locus tag: SA_RS08115 ]
  • pan locus tag?: SAUPAN004207000
  • symbol: udk
  • pan gene symbol?: udk
  • synonym:
  • product: uridine kinase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1439 [new locus tag: SA_RS08115 ]
  • symbol: udk
  • product: uridine kinase
  • replicon: chromosome
  • strand: -
  • coordinates: 1641684..1642307
  • length: 624
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAAGCTACTACAATCATTGGCATAGCTGGTGGATCTGGCTCAGGAAAAACAACTGTA
    ACTAACGAAATTATGAAAAACTTAGAAGGTCATAGTGTCGCTTTACTTGCTCAAGATTAC
    TATTATAAAGATCAAAAGCACTTGACTTTCGACGAGCGCCTAGAAACCAATTATGACCAT
    CCATTTGCATTCGATAATGATTTATTAATTGAAAATCTTAAAGACTTGAAAAATGGTAAA
    GCAGTAGAAGTACCGACATATGATTATGCTAGTCATACAAGAAGTGACATTACCATTGAT
    TTTAAACCTAAAGATGTTATTATCGTAGAAGGTATTTTCGCTTTAGAAAATAAGGTATTA
    CGTGATATGATGGATGTTAAAATATATGTTGATACAGATGCAGACTTGAGAATATTACGC
    CGTTTAACACGAGATACTAAAGAGCGTGGGCGTTCAATGGACTCTGTTATCAATCAATAT
    TTAAGTGTTGTTAGACCTATGCATGACCAATTTATTGAACCGACTAAGAAATATGCTGAT
    ATAATTATTCCTGAAGGTGGGAGCAATAAAGTTGCAATAGATATTATGACAACAAAAATT
    CAGTCTTTAGTTAGCAAGCAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    624

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1439 [new locus tag: SA_RS08115 ]
  • symbol: Udk
  • description: uridine kinase
  • length: 207
  • theoretical pI: 6.03587
  • theoretical MW: 23504.7
  • GRAVY: -0.395652

Function[edit source | edit]

  • reaction:
    EC 2.7.1.48?  ExPASy
    Uridine kinaseATP + uridine = ADP + UMPATP + cytidine = ADP + CMP
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesuridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 294.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPantothenate and coenzyme Apantothenate kinase (TIGR00554; EC 2.7.1.33; HMM-score: 36.2)
    putative cytidylate kinase (TIGR02173; EC 2.7.4.14; HMM-score: 26.1)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionscytidylate kinase (TIGR00017; EC 2.7.4.14; HMM-score: 20.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMolybdopterinmolybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 19.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPantothenate and coenzyme Adephospho-CoA kinase (TIGR00152; EC 2.7.1.24; HMM-score: 18.9)
    Cellular processesCellular processesToxin production and resistanceputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 18.5)
    MetabolismTransport and binding proteinsUnknown substrateputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 18.5)
    MetabolismCentral intermediary metabolismNitrogen metabolismurease accessory protein UreG (TIGR00101; HMM-score: 17.3)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionsdTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 16.3)
    MetabolismCentral intermediary metabolismSulfur metabolismadenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 15.5)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel import ATP-binding protein NikD (TIGR02770; HMM-score: 14.6)
    P-type DNA transfer ATPase VirB11 (TIGR02788; HMM-score: 14.5)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidescellulose synthase operon protein YhjQ (TIGR03371; HMM-score: 13.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalamincobalamin biosynthesis protein CobW (TIGR02475; HMM-score: 13.2)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairorc1/cdc6 family replication initiation protein (TIGR02928; HMM-score: 12.9)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesLAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 12.5)
    Signal transductionRegulatory functionsProtein interactionsLAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 12.5)
    Cellular processesCellular processesConjugationP-type conjugative transfer ATPase TrbB (TIGR02782; HMM-score: 12.3)
    MetabolismCentral intermediary metabolismPhosphorus compoundsphosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 11.1)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR01846; HMM-score: 10.8)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 10.5)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 10)
    MetabolismTransport and binding proteinsOtherpigment precursor permease (TIGR00955; HMM-score: 8.7)
  • TheSEED:  
    Nucleosides and NucleotidesPyrimidinespyrimidine conversions Uridine kinase (EC 2.7.1.48) [C1] 
  • PFAM:
    P-loop_NTPase (CL0023) PRK; Phosphoribulokinase / Uridine kinase family (PF00485; HMM-score: 157.6)
    AAA_18; AAA domain (PF13238; HMM-score: 39.7)
    dNK; Deoxynucleoside kinase (PF01712; HMM-score: 23)
    AAA_17; AAA domain (PF13207; HMM-score: 22.5)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 21.2)
    Cytidylate_kin; Cytidylate kinase (PF02224; HMM-score: 20.7)
    CoaE; Dephospho-CoA kinase (PF01121; HMM-score: 20.6)
    ABC_tran; ABC transporter (PF00005; HMM-score: 19.5)
    AAA_33; AAA domain (PF13671; HMM-score: 18.9)
    MobB; Molybdopterin guanine dinucleotide synthesis protein B (PF03205; HMM-score: 17.7)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 17.4)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 17.1)
    AAA_26; AAA domain (PF13500; HMM-score: 16.9)
    AAA_28; AAA domain (PF13521; HMM-score: 16.2)
    Zeta_toxin; Zeta toxin (PF06414; HMM-score: 16)
    AAA_19; AAA domain (PF13245; HMM-score: 16)
    NTPase_1; NTPase (PF03266; HMM-score: 15.1)
    ArgK; ArgK protein (PF03308; HMM-score: 14.5)
    CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 14.5)
    Thymidylate_kin; Thymidylate kinase (PF02223; HMM-score: 14.4)
    T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 14.3)
    APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 14.1)
    AAA_30; AAA domain (PF13604; HMM-score: 13.7)
    AAA_22; AAA domain (PF13401; HMM-score: 13.3)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 12.5)
    TrwB_AAD_bind; Type IV secretion-system coupling protein DNA-binding domain (PF10412; HMM-score: 12)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.168
    • Ymax_pos: 23
    • Cmax: 0.156
    • Cmax_pos: 23
    • Smax: 0.322
    • Smax_pos: 4
    • Smean: 0.199
    • D: 0.18
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKATTIIGIAGGSGSGKTTVTNEIMKNLEGHSVALLAQDYYYKDQKHLTFDERLETNYDHPFAFDNDLLIENLKDLKNGKAVEVPTYDYASHTRSDITIDFKPKDVIIVEGIFALENKVLRDMMDVKIYVDTDADLRILRRLTRDTKERGRSMDSVINQYLSVVRPMHDQFIEPTKKYADIIIPEGGSNKVAIDIMTTKIQSLVSKQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]