From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01715
  • pan locus tag?: SAUPAN004207000
  • symbol: SAOUHSC_01715
  • pan gene symbol?: udk
  • synonym:
  • product: uridine kinase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01715
  • symbol: SAOUHSC_01715
  • product: uridine kinase
  • replicon: chromosome
  • strand: -
  • coordinates: 1620429..1621052
  • length: 624
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAAGCTACTACAATCATTGGCATAGCTGGTGGATCTGGCTCAGGAAAAACAACTGTA
    ACTAACGAAATTATGAAAAACTTAGAAGGTCATAGTGTCGCTTTACTTGCTCAAGATTAC
    TATTATAAAGATCAAAAGCACTTGACTTTCGACGAGCGCCTAGAAACCAATTATGACCAT
    CCATTTGCATTCGATAATGATTTATTAATTGAAAATCTTAAAGACTTGAAAAATGGTAAA
    GCAGTAGAAGTACCGACATATGATTATGCTAGTCATACAAGAAGTGACATTACCATTGAT
    TTTAAACCTAAAGATGTTATTATCGTAGAAGGCATTTTCGCTTTAGAAAATAAGGTATTA
    CGTGATATGATGGATGTTAAAATATATGTTGATACAGATGCAGACTTGAGAATATTACGC
    CGTTTAACACGAGATACTAAAGAGCGTGGGCGTTCAATGGACTCTGTTATCAATCAATAT
    TTAAGTGTTGTTAGACCTATGCATGACCAATTTATTGAACCGACTAAGAAATATGCTGAT
    ATAATTATTCCTGAAGGTGGGAGCAATAAAGTTGCAATAGATATTATGACAACAAAAATT
    CAGTCTTTAGTTAGCAAGCAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    624

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01715
  • symbol: SAOUHSC_01715
  • description: uridine kinase
  • length: 207
  • theoretical pI: 6.03587
  • theoretical MW: 23504.7
  • GRAVY: -0.395652

Function[edit source | edit]

  • reaction:
    EC 2.7.1.48?  ExPASy
    Uridine kinaseATP + uridine = ADP + UMPATP + cytidine = ADP + CMP
  • TIGRFAM:
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesSalvage of nucleosides and nucleotidesuridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 294.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPantothenate and coenzyme Apantothenate kinase (TIGR00554; EC 2.7.1.33; HMM-score: 36.2)
    putative cytidylate kinase (TIGR02173; EC 2.7.4.14; HMM-score: 26.1)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionscytidylate kinase (TIGR00017; EC 2.7.4.14; HMM-score: 20.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMolybdopterinmolybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 19.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPantothenate and coenzyme Adephospho-CoA kinase (TIGR00152; EC 2.7.1.24; HMM-score: 18.9)
    Cellular processesCellular processesToxin production and resistanceputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 18.5)
    MetabolismTransport and binding proteinsUnknown substrateputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 18.5)
    MetabolismCentral intermediary metabolismNitrogen metabolismurease accessory protein UreG (TIGR00101; HMM-score: 17.3)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionsdTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 16.3)
    MetabolismCentral intermediary metabolismSulfur metabolismadenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 15.5)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsnickel import ATP-binding protein NikD (TIGR02770; HMM-score: 14.6)
    P-type DNA transfer ATPase VirB11 (TIGR02788; HMM-score: 14.5)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidescellulose synthase operon protein YhjQ (TIGR03371; HMM-score: 13.7)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalamincobalamin biosynthesis protein CobW (TIGR02475; HMM-score: 13.2)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairorc1/cdc6 family replication initiation protein (TIGR02928; HMM-score: 12.9)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesLAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 12.5)
    Signal transductionRegulatory functionsProtein interactionsLAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 12.5)
    Cellular processesCellular processesConjugationP-type conjugative transfer ATPase TrbB (TIGR02782; HMM-score: 12.3)
    MetabolismCentral intermediary metabolismPhosphorus compoundsphosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 11.1)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion system ATPase (TIGR01846; HMM-score: 10.8)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 10.5)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 10)
    MetabolismTransport and binding proteinsOtherpigment precursor permease (TIGR00955; HMM-score: 8.7)
  • TheSEED:  
    Nucleosides and NucleotidesPyrimidinespyrimidine conversions Uridine kinase (EC 2.7.1.48) [C1] 
  • PFAM:
    P-loop_NTPase (CL0023) PRK; Phosphoribulokinase / Uridine kinase family (PF00485; HMM-score: 157.6)
    AAA_18; AAA domain (PF13238; HMM-score: 39.7)
    dNK; Deoxynucleoside kinase (PF01712; HMM-score: 23)
    AAA_17; AAA domain (PF13207; HMM-score: 22.5)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 21.2)
    Cytidylate_kin; Cytidylate kinase (PF02224; HMM-score: 20.7)
    CoaE; Dephospho-CoA kinase (PF01121; HMM-score: 20.6)
    ABC_tran; ABC transporter (PF00005; HMM-score: 19.5)
    AAA_33; AAA domain (PF13671; HMM-score: 18.9)
    MobB; Molybdopterin guanine dinucleotide synthesis protein B (PF03205; HMM-score: 17.7)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 17.4)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 17.1)
    AAA_26; AAA domain (PF13500; HMM-score: 16.9)
    AAA_28; AAA domain (PF13521; HMM-score: 16.2)
    Zeta_toxin; Zeta toxin (PF06414; HMM-score: 16)
    AAA_19; AAA domain (PF13245; HMM-score: 16)
    NTPase_1; NTPase (PF03266; HMM-score: 15.1)
    ArgK; ArgK protein (PF03308; HMM-score: 14.5)
    CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 14.5)
    Thymidylate_kin; Thymidylate kinase (PF02223; HMM-score: 14.4)
    T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 14.3)
    APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 14.1)
    AAA_30; AAA domain (PF13604; HMM-score: 13.7)
    AAA_22; AAA domain (PF13401; HMM-score: 13.3)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 12.5)
    TrwB_AAD_bind; Type IV secretion-system coupling protein DNA-binding domain (PF10412; HMM-score: 12)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.168
    • Ymax_pos: 23
    • Cmax: 0.156
    • Cmax_pos: 23
    • Smax: 0.322
    • Smax_pos: 4
    • Smean: 0.199
    • D: 0.18
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKATTIIGIAGGSGSGKTTVTNEIMKNLEGHSVALLAQDYYYKDQKHLTFDERLETNYDHPFAFDNDLLIENLKDLKNGKAVEVPTYDYASHTRSDITIDFKPKDVIIVEGIFALENKVLRDMMDVKIYVDTDADLRILRRLTRDTKERGRSMDSVINQYLSVVRPMHDQFIEPTKKYADIIIPEGGSNKVAIDIMTTKIQSLVSKQ

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]