From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1503 [new locus tag: SA_RS08465 ]
  • pan locus tag?: SAUPAN004298000
  • symbol: rpmI
  • pan gene symbol?: rpmI
  • synonym:
  • product: 50S ribosomal protein L35

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1503 [new locus tag: SA_RS08465 ]
  • symbol: rpmI
  • product: 50S ribosomal protein L35
  • replicon: chromosome
  • strand: -
  • coordinates: 1711119..1711319
  • length: 201
  • essential: yes DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGCCAAAAATGAAAACTCACCGCGGAGCAGCTAAACGTGTTAAAAGAACTGCTTCAGGT
    CAATTAAAACGTTCAAGAGCTTTCACATCTCACTTATTCGCAAACAAGAGCACTAAACAA
    AAACGTCAATTACGTAAAGCTAGATTAGTGTCTAAGAGCGATATGAAACGTGTAAAACAA
    TTATTAGCATACAAAAAATAA
    60
    120
    180
    201

Protein[edit source | edit]

Protein Data Bank: 5LI0
Protein Data Bank: 4WCE
Protein Data Bank: 4WFB
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 5HL7

General[edit source | edit]

  • locus tag: SA1503 [new locus tag: SA_RS08465 ]
  • symbol: RpmI
  • description: 50S ribosomal protein L35
  • length: 66
  • theoretical pI: 12.8298
  • theoretical MW: 7697.22
  • GRAVY: -1.12879

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein bL35 (TIGR00001; HMM-score: 87.4)
  • TheSEED:  
    Protein MetabolismProtein biosynthesisRibosome LSU bacterial LSU ribosomal protein L35p 
    VirulenceVirulence - no subcategoryMycobacterium virulence operon involved in protein synthesis (LSU ribosomal proteins) LSU ribosomal protein L35p 
  • PFAM:
    no clan definedRibosomal_L35p; Ribosomal protein L35 (PF01632; HMM-score: 87.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 0.67
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.317
    • Ymax_pos: 28
    • Cmax: 0.216
    • Cmax_pos: 28
    • Smax: 0.834
    • Smax_pos: 4
    • Smean: 0.586
    • D: 0.422
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MPKMKTHRGAAKRVKRTASGQLKRSRAFTSHLFANKSTKQKRQLRKARLVSKSDMKRVKQLLAYKK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: L20_leader
    L20_leader (RNA) important in Ribosome biogenesisRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]