From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1570 [new locus tag: SA_RS08855 ]
  • pan locus tag?: SAUPAN004426000
  • symbol: SA1570
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1570 [new locus tag: SA_RS08855 ]
  • symbol: SA1570
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1800216..1801007
  • length: 792
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    TTGGAGCAGTTTTATCAATTAGGGTGGACACTTGATTCAGCAGGTGGTGCATCTGGTGAA
    GCATATATGGCTGAACAAGATGGACAAAAGTTGTTTTTAAAACGAAATTCAAATCCATTT
    ATTGCGGCATTATCAGCAGAAGGTATTGTGCCCAAATTAGTATGGACGAAACGCATAGAA
    ACAGGCGAGGTTGTTACAGCACAACATTGGAAAAATGGGCGTGAACTATCTTCAAACGAA
    ATGAAGCAAACAAGAGTTGCACATTTATTAAAGAAGATACACAATTCTAGACCTTTATTA
    AGTATGTTAAAGCGTATGGAAATGGAACCTATTACTCCTGAGATTATGCTTAATAAAATT
    AATGCCTCTTTATCAAGAGAAGTTTTAACACATCATATTGTGAGAAAATCATTAACCTAT
    TTAGAAGAGCATATACCGAGTTTAGATTCGCGTTTTTTCACTGTTGTACATGGTGATGTG
    AATCATAATAATTGGTTATTATCCGATCGAGATGAACTATTTTTAGTTGATTGGGAAGGT
    GCAATGATTGCAGACCCGGCAATTGATATCGGAATGCTGCTTTACAACTATGTTCCACAA
    CAACAATGGTCTGAATGGCTTGAAACATATGGTGTTCAAGAGAGCTTGAATTTAAATAAA
    CGTATGAAATGGTATACGGTAATTCAATCTATAGGTCTTGTTCAATGGTATGAAGAGCAA
    AAAAGATATAAGGATATGAACACTTGGCTTAAATTCCTAAATGAAGTTATGAATAGTAAC
    ATGTTTATTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    792

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1570 [new locus tag: SA_RS08855 ]
  • symbol: SA1570
  • description: hypothetical protein
  • length: 263
  • theoretical pI: 6.52097
  • theoretical MW: 30752.1
  • GRAVY: -0.385171

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiaminethiamine kinase (TIGR02721; EC 2.7.1.89; HMM-score: 30)
    Cellular processesCellular processesSporulation and germinationspore coat protein YsxE (TIGR02904; HMM-score: 24.1)
    Unknown functionGeneralKae1-associated kinase Bud32 (TIGR03724; EC 2.7.-.-; HMM-score: 12)
  • TheSEED:  
    Putative phosphotransferase YtmP 
  • PFAM:
    PKinase (CL0016) APH; Phosphotransferase enzyme family (PF01636; HMM-score: 71.8)
    Choline_kinase; Choline/ethanolamine kinase (PF01633; HMM-score: 34.2)
    EcKinase; Ecdysteroid kinase (PF02958; HMM-score: 27.2)
    Fructosamin_kin; Fructosamine kinase (PF03881; HMM-score: 17.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.111
    • Ymax_pos: 27
    • Cmax: 0.139
    • Cmax_pos: 24
    • Smax: 0.15
    • Smax_pos: 22
    • Smean: 0.07
    • D: 0.095
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MEQFYQLGWTLDSAGGASGEAYMAEQDGQKLFLKRNSNPFIAALSAEGIVPKLVWTKRIETGEVVTAQHWKNGRELSSNEMKQTRVAHLLKKIHNSRPLLSMLKRMEMEPITPEIMLNKINASLSREVLTHHIVRKSLTYLEEHIPSLDSRFFTVVHGDVNHNNWLLSDRDELFLVDWEGAMIADPAIDIGMLLYNYVPQQQWSEWLETYGVQESLNLNKRMKWYTVIQSIGLVQWYEEQKRYKDMNTWLKFLNEVMNSNMFI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]