From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1653 [new locus tag: SA_RS09345 ]
  • pan locus tag?: SAUPAN004760000
  • symbol: TRAP
  • pan gene symbol?: traP
  • synonym:
  • product: signal transduction protein TRAP

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1653 [new locus tag: SA_RS09345 ]
  • symbol: TRAP
  • product: signal transduction protein TRAP
  • replicon: chromosome
  • strand: +
  • coordinates: 1887575..1888078
  • length: 504
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAAGAAACTATATACATCTTATGGCACTTATGGATTTTTACATCAAATAAAAATCAAT
    AACCCGACCCATCAACTATTCCAATTTTCAGCATCAGATACTTCAGTTATTTTTGAAGAA
    ACTGATGGTGAGACTGTTTTAAAATCACCTTCAATATATGAAGTTATTAAAGAAATTGGT
    GAATTCAGTGAACATCATTTCTATTGTGCAATCTTCATTCCTTCAACAGAAGATCATGCA
    TATCAACTTGAAAAGAAACTGATTAGTGTAGACGATAATTTCAGAAACTTTGGTGGCTTT
    AAAAGCTATCGTTTGTTAAGACCTGCTAAAGGTACAACATATAAAATTTATTTCGGATTT
    GCTGATCGACATGCATACGAAGACTTTAAGCAATCTGATGCCTTTAATGACCATTTTTCA
    AAAGACGCATTAAGTCATTACTTTGGTTCAAGCGGACAACATTCAAGTTATTTTGAAAGA
    TATCTATACCCAATAAAAGAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    504

Protein[edit source | edit]

Protein Data Bank: 4AE5

General[edit source | edit]

  • locus tag: SA1653 [new locus tag: SA_RS09345 ]
  • symbol: TRAP
  • description: signal transduction protein TRAP
  • length: 167
  • theoretical pI: 6.60285
  • theoretical MW: 19547.6
  • GRAVY: -0.58024

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, PigmentsTetrapyrrolesCPO analysis Uncharacterized protein, homolog of B.subtilis yhgC 
  • PFAM:
    Dim_A_B_barrel (CL0032) ABM; Antibiotic biosynthesis monooxygenase (PF03992; HMM-score: 18.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.134
    • Ymax_pos: 31
    • Cmax: 0.109
    • Cmax_pos: 31
    • Smax: 0.238
    • Smax_pos: 25
    • Smean: 0.148
    • D: 0.14
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKLYTSYGTYGFLHQIKINNPTHQLFQFSASDTSVIFEETDGETVLKSPSIYEVIKEIGEFSEHHFYCAIFIPSTEDHAYQLEKKLISVDDNFRNFGGFKSYRLLRPAKGTTYKIYFGFADRHAYEDFKQSDAFNDHFSKDALSHYFGSSGQHSSYFERYLYPIKE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • TRAP no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]