From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004760000
  • symbol?: traP
  • description?: signal transduction protein TRAP

      descriptions from strain specific annotations:

    • signal transduction protein TRAP
    • RNAIII-activating protein TRAP
    • signal transduction protein TRAP (Target of RNAIII-activatingprotein)
  • strand?: +
  • coordinates?: 4974083..4974586
  • synteny block?: BlockID0036920
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1653 (TRAP)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1791 (yhgC)
    08BA02176:
    C248_1876 (trap)
    11819-97:
    MS7_1840 (traP)
    71193:
    ST398NM01_1900
    ECT-R 2:
    ECTR2_1677
    ED133:
    SAOV_1830 (traP)
    ED98:
    SAAV_1854
    HO 5096 0412:
    SAEMRSA15_17390 (trap)
    JH1:
    SaurJH1_1922
    JH9:
    SaurJH9_1888
    JKD6008:
    SAA6008_01792
    JKD6159:
    SAA6159_01763
    LGA251:
    SARLGA251_17180 (trap)
    M013:
    M013TW_1841
    MRSA252:
    SAR1926 (trap)
    MSHR1132:
    SAMSHR1132_16810
    MSSA476:
    SAS1756
    Mu3:
    SAHV_1820 (traP)
    Mu50:
    SAV1835 (traP)
    MW2:
    MW1775
    RF122:
    SAB1766 (traP)
    ST398:
    SAPIG1900
    T0131:
    SAT0131_01954
    TCH60:
    HMPREF0772_11310 (trap)
    TW20:
    SATW20_18290 (trap)
    USA300_TCH1516:
    USA300HOU_1827
    VC40:
    SAVC_08405

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKLYTSYGTYGFLHQIKINNPTHQLFQFSASDTSVIFEETDGETVLKSPSIYEVIKEIG
    N315            MKKLYTSYGTYGFLHQIKINNPTHQLFQFSASDTSVIFEETDGETVLKSPSIYEVIKEIG
    NCTC8325        MKKLYTSYGTYGFLHQIKINNPTHQLFQFSASDTSVIFEETDGETVLKSPSIYEVIKEIG
    Newman          MKKLYTSYGTYGFLHQIKINNPTHQLFQFSASDTSVIFEETDGETVLKSPSIYEVIKEIG
    USA300_FPR3757  MKKLYTSYGTYGFLHQIKINNPTHQLFQFSASDTSVIFEETDGETVLKSPSIYEVIKEIG
                    ************************************************************

    COL             EFSEHHFYCAIFIPSTEDHAYQLEKKLISVDDNFRNFGGFKSYRLLRPAKGTTYKIYFGF
    N315            EFSEHHFYCAIFIPSTEDHAYQLEKKLISVDDNFRNFGGFKSYRLLRPAKGTTYKIYFGF
    NCTC8325        EFSEHHFYCAIFIPSTEDHAYQLEKKLISVDDNFRNFGGFKSYRLLRPAKGTTYKIYFGF
    Newman          EFSEHHFYCAIFIPSTEDHAYQLEKKLISVDDNFRNFGGFKSYRLLRPAKGTTYKIYFGF
    USA300_FPR3757  EFSEHHFYCAIFIPSTEDHAYQLEKKLISVDDNFRNFGGFKSYRLLRPAKGTTYKIYFGF
                    ************************************************************

    COL             ADRHAYEDFKQSDAFNDHFSKDALSHYFGSSGQHSSYFERYLYPIKE
    N315            ADRHAYEDFKQSDAFNDHFSKDALSHYFGSSGQHSSYFERYLYPIKE
    NCTC8325        ADRHAYEDFKQSDAFNDHFSKDALSHYFGSSGQHSSYFERYLYPIKE
    Newman          ADRHAYEDFKQSDAFNDHFSKDALSHYFGSSGQHSSYFERYLYPIKE
    USA300_FPR3757  ADRHAYEDFKQSDAFNDHFSKDALSHYFGSSGQHSSYFERYLYPIKE
                    ***********************************************