From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1657 [new locus tag: SA_RS09365 ]
  • pan locus tag?: SAUPAN004764000
  • symbol: SA1657
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1657 [new locus tag: SA_RS09365 ]
  • symbol: SA1657
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1890856..1891221
  • length: 366
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAGCATCACGCATTCTATTCGGTATCGGTGTTGGCGTAGCAGCTGGTTTTGTAGTT
    GCACTTCAAGGACGAGACGACAAAAGTGTCAAGAACAACACGATCGATCGTACTGCCCCT
    ACTGGTTCAAAATCAGAACTACAACGTGAATTTGAAACGATTAAACAAAGTTTTAATGAC
    ATTTTAAACTATGGTGTTCAAATTAAAAACGAAAGTGCGGAATTTGGTAGTTCAATTGGT
    GGTGAAATTAAGTCATTACTTGGAAACTTCAAATCTGACATTAATCCTAATATTGAACGT
    TTACAGTCACACATCGAAAATTTACAAAATCGTGGCGAGGATATTGGAAACGAAATTTCT
    AAGTAG
    60
    120
    180
    240
    300
    360
    366

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1657 [new locus tag: SA_RS09365 ]
  • symbol: SA1657
  • description: hypothetical protein
  • length: 121
  • theoretical pI: 5.92008
  • theoretical MW: 13211.7
  • GRAVY: -0.490083

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    two transmembrane protein (TIGR04527; HMM-score: 16.3)
  • TheSEED:  
    Membrane TransportProtein translocation across cytoplasmic membraneEcsAB transporter affecting expression and secretion of secretory preproteins Hypothetical protein SAV1839 
    CBSS-176279.3.peg.1262 Hypothetical protein SAV1839 
  • PFAM:
    no clan definedDUF1732; Domain of unknown function (DUF1732) (PF08340; HMM-score: 17.9)
    Baculo_PEP_C; Baculovirus polyhedron envelope protein, PEP, C terminus (PF04513; HMM-score: 14.9)
    Lectin_N; Hepatic lectin, N-terminal domain (PF03954; HMM-score: 14.7)
    Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 13.3)
    YtxH; YtxH-like protein (PF12732; HMM-score: 8.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: GFVVALQG
  • SignalP: no predicted signal peptide
    • Ymax: 0.266
    • Ymax_pos: 22
    • Cmax: 0.141
    • Cmax_pos: 22
    • Smax: 0.637
    • Smax_pos: 5
    • Smean: 0.516
    • D: 0.364
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKASRILFGIGVGVAAGFVVALQGRDDKSVKNNTIDRTAPTGSKSELQREFETIKQSFNDILNYGVQIKNESAEFGSSIGGEIKSLLGNFKSDINPNIERLQSHIENLQNRGEDIGNEISK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]