From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1665 [new locus tag: SA_RS09410 ]
  • pan locus tag?: SAUPAN004780000
  • symbol: SA1665
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1665 [new locus tag: SA_RS09410 ]
  • symbol: SA1665
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1901505..1901969
  • length: 465
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGATAGACAGAGTTTTACAGATTTAATTCAAACAAAATTTAAAATGGTTCGTATAGAG
    GCTGGTTATACGCAAGATACTATGGCGCAAACAATTGGACTTTCTAAAAAGACTTTAGTA
    CAAATCGAAAAAGAGAGAGTATTACCAAACTGGACAACTTGTATTTCAATTTGTGCATTA
    TTCAGAGACTCTGAAGTATTAAACAGTACATTTGGCTGTGATCCATTAGAAATCGTTCAA
    ACAATTTCAAGAAATCACTGTGCATATCCAAACCATGCACCAACAAGTGATATTTATTGG
    AATAACATTGAGACTCGTAATGGGTACATTTTACAAAGTAACAAAGTAAGCAATATTTAT
    CGTGTATTAAATCCAGATAACCAACCAATTTTCGGTACTTCTAAAATGAGAGAAGCTGAA
    ACATACTTTAACAGAAATGCTAAAGAAGAATTAGTACATATCTAG
    60
    120
    180
    240
    300
    360
    420
    465

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1665 [new locus tag: SA_RS09410 ]
  • symbol: SA1665
  • description: hypothetical protein
  • length: 154
  • theoretical pI: 7.38252
  • theoretical MW: 17798.1
  • GRAVY: -0.465584

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator, y4mF family (TIGR03070; HMM-score: 17.9)
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 14.1)
  • TheSEED:  
    HTH domain protein SA1665, binds to mecA promoter region 
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 25.2)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 23.5)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 20.3)
    Pou; Pou domain - N-terminal to homeobox domain (PF00157; HMM-score: 13.7)
    HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 12.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.119
    • Ymax_pos: 11
    • Cmax: 0.11
    • Cmax_pos: 30
    • Smax: 0.188
    • Smax_pos: 2
    • Smean: 0.137
    • D: 0.126
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MDRQSFTDLIQTKFKMVRIEAGYTQDTMAQTIGLSKKTLVQIEKERVLPNWTTCISICALFRDSEVLNSTFGCDPLEIVQTISRNHCAYPNHAPTSDIYWNNIETRNGYILQSNKVSNIYRVLNPDNQPIFGTSKMREAETYFNRNAKEELVHI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Miriam Ender, Brigitte Berger-Bächi, Nadine McCallum
A novel DNA-binding protein modulating methicillin resistance in Staphylococcus aureus.
BMC Microbiol.: 2009, 9;15
[PubMed:19173709] [WorldCat.org] [DOI] (I e)