From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1744 [new locus tag: SA_RS10015 ]
  • pan locus tag?: SAUPAN004996000
  • symbol: SA1744
  • pan gene symbol?: pmtD
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1744 [new locus tag: SA_RS10015 ]
  • symbol: SA1744
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1996925..1997665
  • length: 741
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAGAATTTTAAATTTAGTTAAGTATGATTTTTATAGTATATTTAAAAGTCCTTTAACA
    TATTTAGCGATACTAGTCGTATCTAGTTTGATTGCAACTCAAAGTATACTTATGGCAAAT
    TCGATGGATAACCCGAAACATATTATTGTCTATGGATCTGTATTTGCTGCAGCAAAATGG
    TTATTGTTAATAATTGGATTAATGTTTGTTGTTAAGACAATTACGCGTGATTTTTCACAA
    GGTACAATTCAACTATATATGAGTAAAGTTAAAACACGCGTTGGATACATTATTTCGAAA
    ACAATTTCAATTATTTTAATTTCAATATTATTTGCATTAATTCATTATGTGATTTTGATT
    GTTGTGCAGGCATCTAGTAATGGAAAAAATTTGGCGTTTTCTAAATATGTAGATAATTTA
    TGGTTCTTCCTAATCTTTTTACTATTCTTTGGCTTGTTTTTATTCTTAATCACACTTGCA
    TCACAAAAAACAGCAATGATATTTTCATTAGGTGTATTTTTAGTACTCATTGTACCGTTT
    ATTAAACCTTTTATTACATTTATCCCAAGATACGGTGAAAAAGTTTTAGATGCTTTTGAT
    TATATCCCTTTTGCTTACTTAACTGATAAAATGATTAGCTCTAACTTTGATTTTAGCAAT
    TGGCAATGGGTAATTTCATTAGGTTCTATAGTGATATTCTTCATTTTGAATATCTTATAT
    GTCGCTAAAAAAGACATTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    741

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1744 [new locus tag: SA_RS10015 ]
  • symbol: SA1744
  • description: hypothetical protein
  • length: 246
  • theoretical pI: 10.1289
  • theoretical MW: 28138.8
  • GRAVY: 1.00772

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    FIG01108144: hypothetical protein 
  • PFAM:
    ABC-2 (CL0181) ABC2_membrane_2; ABC-2 family transporter protein (PF12679; HMM-score: 37.4)
    ABC2_membrane_3; ABC-2 family transporter protein (PF12698; HMM-score: 21.9)
    ABC2_membrane_4; ABC-2 family transporter protein (PF12730; HMM-score: 19.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 6
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 0
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.347
    • Ymax_pos: 40
    • Cmax: 0.319
    • Cmax_pos: 40
    • Smax: 0.489
    • Smax_pos: 30
    • Smean: 0.248
    • D: 0.309
  • predicted transmembrane helices (TMHMM): 6

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRILNLVKYDFYSIFKSPLTYLAILVVSSLIATQSILMANSMDNPKHIIVYGSVFAAAKWLLLIIGLMFVVKTITRDFSQGTIQLYMSKVKTRVGYIISKTISIILISILFALIHYVILIVVQASSNGKNLAFSKYVDNLWFFLIFLLFFGLFLFLITLASQKTAMIFSLGVFLVLIVPFIKPFITFIPRYGEKVLDAFDYIPFAYLTDKMISSNFDFSNWQWVISLGSIVIFFILNILYVAKKDI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SA1748
    SA1748 (TF) important in Hypothetical ABC transporterRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Som S Chatterjee, Hwang-Soo Joo, Anthony C Duong, Thomas D Dieringer, Vee Y Tan, Yan Song, Elizabeth R Fischer, Gordon Y C Cheung, Min Li, Michael Otto
Essential Staphylococcus aureus toxin export system.
Nat. Med.: 2013, 19(3);364-7
[PubMed:23396209] [WorldCat.org] [DOI] (I p)