From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004996000
  • symbol?: pmtD
  • description?: ABC transporter permease

      descriptions from strain specific annotations:

    • ABC transporter permease
    • ABC-2 transporter family protein
    • membrane protein
  • strand?: -
  • coordinates?: 5178194..5178934
  • synteny block?: BlockID0038770
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1888
    08BA02176:
    C248_2017
    11819-97:
    MS7_1965
    71193:
    ST398NM01_2051
    ECT-R 2:
    ECTR2_1802
    ED133:
    SAOV_2032
    ED98:
    SAAV_1997
    HO 5096 0412:
    SAEMRSA15_18460
    JH1:
    SaurJH1_2020
    JH9:
    SaurJH9_1987
    JKD6008:
    SAA6008_01966
    JKD6159:
    SAA6159_01861
    LGA251:
    SARLGA251_18140
    M013:
    M013TW_1967
    MRSA252:
    SAR2022
    MSHR1132:
    SAMSHR1132_17740
    MSSA476:
    SAS1854
    Mu3:
    SAHV_1915
    Mu50:
    SAV1930
    MW2:
    MW1871
    RF122:
    SAB1866c
    ST398:
    SAPIG2051
    T0131:
    SAT0131_02060
    TCH60:
    HMPREF0772_11211
    TW20:
    SATW20_19240
    USA300_TCH1516:
    USA300HOU_1933
    VC40:
    SAVC_08910

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRILNLVKYDFYSIFKSPLTYLAILVVSSLIATQSILMANSMDNPKHIIVYGSVFAAAKW
    N315            MRILNLVKYDFYSIFKSPLTYLAILVVSSLIATQSILMANSMDNPKHIIVYGSVFAAAKW
    NCTC8325        MRILNLVKYDFYSIFKSPLTYLAILVVSSLIATQSILMANSMDNPKHIIVYGSVFAAAKW
    Newman          MRILNLVKYDFYSIFKSPLTYLAILVVSSLIATQSILMANSMDNPKHIIVYGSVFAAAKW
    USA300_FPR3757  MRILNLVKYDFYSIFKSPLTYLAILVVSSLIATQSILMANSMDNPKHIIVYGSVFAAAKW
                    ************************************************************

    COL             LLLIIGLMFVVKTITRDFSQGTIQLYMSKVKTRVGYIISKTISIILISILFALIHYVILI
    N315            LLLIIGLMFVVKTITRDFSQGTIQLYMSKVKTRVGYIISKTISIILISILFALIHYVILI
    NCTC8325        LLLIIGLMFVVKTITRDFSQGTIQLYMSKVKTRVGYIISKTISIILISILFALIHYVILI
    Newman          LLLIIGLMFVVKTITRDFSQGTIQLYMSKVKTRVGYIISKTISIILISILFALIHYVILI
    USA300_FPR3757  LLLIIGLMFVVKTITRDFSQGTIQLYMSKVKTRVGYIISKTISIILISILFALIHYVILI
                    ************************************************************

    COL             VVQASSNGKNLAFSKYVDNLWFFLIFLLFFGLFLFLITLASQKTAMIFSLGVFLVLIVPF
    N315            VVQASSNGKNLAFSKYVDNLWFFLIFLLFFGLFLFLITLASQKTAMIFSLGVFLVLIVPF
    NCTC8325        VVQASSNGKNLAFSKYVDNLWFFLIFLLFFGLFLFLITLASQKTAMIFSLGVFLVLIVPF
    Newman          VVQASSNGKNLAFSKYVDNLWFFLIFLLFFGLFLFLITLASQKTAMIFSLGVFLVLIVPF
    USA300_FPR3757  VVQASSNGKNLAFSKYVDNLWFFLIFLLFFGLFLFLITLASQKTAMIFSLGVFLVLIVPF
                    ************************************************************

    COL             IKPFITFIPRYGEKVLDAFDYIPFAYLTDKMISSNFDFSNWQWVISLGSIVIFFILNILY
    N315            IKPFITFIPRYGEKVLDAFDYIPFAYLTDKMISSNFDFSNWQWVISLGSIVIFFILNILY
    NCTC8325        IKPFITFIPRYGEKVLDAFDYIPFAYLTDKMISSNFDFSNWQWVISLGSIVIFFILNILY
    Newman          IKPFITFIPRYGEKVLDAFDYIPFAYLTDKMISSNFDFSNWQWVISLGSIVIFFILNILY
    USA300_FPR3757  IKPFITFIPRYGEKVLDAFDYIPFAYLTDKMISSNFDFSNWQWVISLGSIVIFFILNILY
                    ************************************************************

    COL             VAKKDI
    N315            VAKKDI
    NCTC8325        VAKKDI
    Newman          VAKKDI
    USA300_FPR3757  VAKKDI
                    ******