From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1752 [new locus tag: SA_RS10065 ]
  • pan locus tag?: SAUPAN005011000
  • symbol: hlb
  • pan gene symbol?: hlb-1
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1752 [new locus tag: SA_RS10065 ]
  • symbol: hlb
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2005149..2005349
  • length: 201
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGATGGTAAAAAAAACAAAATCCAATTCACTAAAAAAAGTTGCAACACTTGCATTAGCA
    AATTTATTATTAGTTGGTGCACTTACTGACAATAGTGCCAAAGCCGAATCTAAGAAAGAT
    GATACTGATTTGAAGTTAGTTAGTCATAACGTTTATATGTTATCGACCGTTTTGTATCCA
    AACTGGAGACTTTTAACATAA
    60
    120
    180
    201

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1752 [new locus tag: SA_RS10065 ]
  • symbol: Hlb
  • description: hypothetical protein
  • length: 66
  • theoretical pI: 10.4211
  • theoretical MW: 7306.61
  • GRAVY: -0.0181818

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesPathogenesissphingomyelin phosphodiesterase (TIGR03395; EC 3.1.4.12; HMM-score: 14)
  • TheSEED:  
    Beta-hemolysin 
  • PFAM:

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 8.8
    • Cellwall Score: 0.22
    • Extracellular Score: 0.98
    • Internal Helices: 0
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: -0.17
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: -2
    • Predicted Cleavage Site: NSAKAESK
  • SignalP: Signal peptide length 36 aa
    • Ymax: 0.659
    • Ymax_pos: 36
    • Cmax: 0.574
    • Cmax_pos: 36
    • Smax: 0.921
    • Smax_pos: 3
    • Smean: 0.836
    • D: 0.728
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 15927513 NCBI
  • RefSeq: NP_375046 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MMVKKTKSNSLKKVATLALANLLLVGALTDNSAKAESKKDDTDLKLVSHNVYMLSTVLYPNWRLLT

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]