From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1754 [new locus tag: SA_RS10085 ]
  • pan locus tag?: SAUPAN005018000
  • symbol: SA1754
  • pan gene symbol?: scn
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1754 [new locus tag: SA_RS10085 ]
  • symbol: SA1754
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2006528..2006878
  • length: 351
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGAAAATTAGAAAATCTATACTTGCGGGAACTTTAGCAATCGTTTTAGCATCACCACTA
    GTAACTAATCTAGATAAAAATGAGGCACAAGCTAGCACAAGCTTGCCAACATCGAATGAA
    TATCAAAACGAAAAGTTAGCTAATGAATTAAAATCGTTATTAGATGAACTAAATGTTAAT
    GAATTAGCTACTGGAAGTTTAAACACTTATTATAAGCGAACTATAAAAATTTCAGGTCTA
    AAAGCAATGTATGCTCTTAAGTCAAAAGACTTTAAGAAAATGTCAGAAGCAAAATATCAA
    CTTCAAAAGATTTATAACGAAATTGACGAAGCACTAAAAAGTAAATATTAA
    60
    120
    180
    240
    300
    351

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1754 [new locus tag: SA_RS10085 ]
  • symbol: SA1754
  • description: hypothetical protein
  • length: 116
  • theoretical pI: 9.83807
  • theoretical MW: 13052
  • GRAVY: -0.453448

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    pyrimidine 5'-nucleotidase (TIGR01993; EC 3.1.3.5; HMM-score: 13.3)
    MJ0570-related uncharacterized domain (TIGR00290; HMM-score: 13.1)
    integral membrane protein (TIGR04561; HMM-score: 12.4)
  • TheSEED:  
    Involved in expression of fibrinogen binding protein, phage associated 
  • PFAM:
    no clan definedCompInhib_SCIN; Staphylococcal complement inhibitor SCIN (PF11546; HMM-score: 164.7)
    IDEAL; IDEAL domain (PF08858; HMM-score: 17.4)
    EcoR124_C; Type I restriction and modification enzyme - subunit R C terminal (PF12008; HMM-score: 17.3)
    Minor_capsid_3; Minor capsid protein from bacteriophage (PF12691; HMM-score: 16)
    SNARE-fusion (CL0445) Syntaxin_2; Syntaxin-like protein (PF14523; HMM-score: 15.5)
    HUP (CL0039) Diphthami_syn_2; Diphthamide synthase (PF01902; HMM-score: 15)
    no clan definedFapA; Flagellar Assembly Protein A (PF03961; HMM-score: 13.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: NEAQASTS
  • SignalP: Signal peptide length 32 aa
    • Ymax: 0.666
    • Ymax_pos: 32
    • Cmax: 0.619
    • Cmax_pos: 32
    • Smax: 0.925
    • Smax_pos: 16
    • Smean: 0.813
    • D: 0.723
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKIRKSILAGTLAIVLASPLVTNLDKNEAQASTSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGLKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA1754 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SaeR
    SaeR (TF) important in VirulenceRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Suzan H M Rooijakkers, Maartje Ruyken, Anja Roos, Mohamed R Daha, Julia S Presanis, Robert B Sim, Willem J B van Wamel, Kok P M van Kessel, Jos A G van Strijp
Immune evasion by a staphylococcal complement inhibitor that acts on C3 convertases.
Nat. Immunol.: 2005, 6(9);920-7
[PubMed:16086019] [WorldCat.org] [DOI] (P p)