Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005018000
  • symbol?: scn
  • description?: staphylococcal complement inhibitor SCIN

      descriptions from strain specific annotations:

    • staphylococcal complement inhibitor SCIN
    • Involved in expression of fibrinogen binding protein, phage associated
    • staphylococcal complement inhibitor (SCIN)
    • Staphylococcal complement inhibitor
  • strand?: -
  • coordinates?: 5192645..5193726
  • synteny block?: BlockID0038990
  • occurrence?: in 66% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1876 (scn)
    USA300_FPR3757:
    04-02981:
    SA2981_1901
    08BA02176:
    11819-97:
    MS7_1977
    71193:
    ST398NM01_0482
    ECT-R 2:
    ECTR2_1814
    ED133:
    ED98:
    HO 5096 0412:
    SAEMRSA15_18580
    JH1:
    SaurJH1_2034
    JH9:
    SaurJH9_1999
    JKD6008:
    SAA6008_01955 (scn)
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR2035
    MSHR1132:
    MSSA476:
    SAS1866
    Mu3:
    SAHV_1927
    Mu50:
    SAV1942
    MW2:
    MW1884
    RF122:
    ST398:
    T0131:
    SAT0131_02076
    TCH60:
    HMPREF0772_11198
    TW20:
    SATW20_19360 (scn)
    USA300_TCH1516:
    USA300HOU_1946
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MKIRKSILAGTLAIVLASPLVTNLDKNEAQASTSLPTSNEYQNEKLANELKSLLDELNVN
    NCTC8325        MKIRKSILAGTLAIVLASPLVTNLDKNEAQASTSLPTSNEYQNEKLANELKSLLDELNVN
    Newman          MKIRKSILAGTLAIVLASPLVTNLDKNEAQASTSLPTSNEYQNEKLANELKSLLDELNVN
    USA300_FPR3757  MKIRKSILAGTLAIVLASPLVTNLDKNEAQASTSLPTSNEYQNEKLANELKSLLDELNVN
                    ************************************************************

    N315            ELATGSLNTYYKRTIKISGLKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY
    NCTC8325        ELATGSLNTYYKRTIKISGLKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY
    Newman          ELATGSLNTYYKRTIKISGQKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY
    USA300_FPR3757  ELATGSLNTYYKRTIKISGQKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY
                    ******************* ************************************