From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1867 [new locus tag: SA_RS10740 ]
  • pan locus tag?: SAUPAN005330000
  • symbol: SA1867
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1867 [new locus tag: SA_RS10740 ]
  • symbol: SA1867
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2115118..2115573
  • length: 456
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAATAATGACAAACTTCAGCGAATGGTTGAGAACCTTTCGGAAGAAAAATTTGGACGT
    ACGTTTCGACATTGTGCATATTTTAATAAAAGGTTACGTACAACAGGCGGACGTTATCTT
    TTAAAGTCCCATGATATTGAAATTAATCCAAAACAATATGAGCATTATGGAGAAGATGCT
    GTTGTAAAAATTATACTGCACGAATTGTGTCATTATCACTTGCATATTGCTGGTAAAGGT
    TATCAACATAAAGATCAAGATTTTAAACGATTGAGCCAACAGGTTGGAGCGCCTAGATTT
    TGTAACAGCATTGAAAGCTATCAACAACGGGCGAATTATGAATATTATTGTACTAAATGT
    CATGCAAAATATATACGTATCCGTAAAGTTGATACGAATCGTATGCGTTGCGGACATTGC
    AATGGAAAATTAAGAATGAAAAGACAATTGAAATAA
    60
    120
    180
    240
    300
    360
    420
    456

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1867 [new locus tag: SA_RS10740 ]
  • symbol: SA1867
  • description: hypothetical protein
  • length: 151
  • theoretical pI: 10.0258
  • theoretical MW: 18185.8
  • GRAVY: -1.01589

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionsputative regulatory protein, FmdB family (TIGR02605; HMM-score: 21.5)
  • TheSEED:  
    CBSS-393131.3.peg.612 Putative metallopeptidase (Zinc) SprT family 
  • PFAM:
    Peptidase_MA (CL0126) SprT-like; SprT-like family (PF10263; HMM-score: 57)
    Zn_Beta_Ribbon (CL0167) Zn_ribbon_SprT; SprT-like zinc ribbon domain (PF17283; HMM-score: 41.6)
    Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 21.2)
    no clan definedFlhC; Flagellar transcriptional activator (FlhC) (PF05280; HMM-score: 13.7)
    Zn_Beta_Ribbon (CL0167) zf-RRN7; Zinc-finger of RNA-polymerase I-specific TFIIB, Rrn7 (PF11781; HMM-score: 10.6)
    zinc_ribbon_12; Probable zinc-ribbon domain (PF11331; HMM-score: 10.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Zn2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.141
    • Ymax_pos: 13
    • Cmax: 0.103
    • Cmax_pos: 27
    • Smax: 0.274
    • Smax_pos: 8
    • Smean: 0.204
    • D: 0.165
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNNDKLQRMVENLSEEKFGRTFRHCAYFNKRLRTTGGRYLLKSHDIEINPKQYEHYGEDAVVKIILHELCHYHLHIAGKGYQHKDQDFKRLSQQVGAPRFCNSIESYQQRANYEYYCTKCHAKYIRIRKVDTNRMRCGHCNGKLRMKRQLK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]