From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005330000
  • symbol?:
  • description?: Putative metallopeptidase (Zinc) SprT family

      descriptions from strain specific annotations:

    • Putative metallopeptidase (Zinc) SprT family
    • metallopeptidase (SprT family) family protein
    • protein sprT-like
    • Protein sprT-like protein
    • sprT-like family protein
    • SprT family peptidase
    • zinc metalloprotease
    • Metallopeptidase, SprT family
  • strand?: -
  • coordinates?: 5507414..5507845
  • synteny block?: BlockID0041270
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2003
    08BA02176:
    C248_2073
    11819-97:
    MS7_2079
    71193:
    ST398NM01_2103
    ECT-R 2:
    ECTR2_1918
    ED133:
    SAOV_2104c
    ED98:
    SAAV_2114
    HO 5096 0412:
    SAEMRSA15_19720
    JH1:
    SaurJH1_2136
    JH9:
    SaurJH9_2099
    JKD6008:
    SAA6008_02101
    JKD6159:
    SAA6159_01977
    LGA251:
    SARLGA251_18650
    M013:
    M013TW_2021
    MRSA252:
    SAR2150
    MSHR1132:
    SAMSHR1132_18870
    MSSA476:
    SAS1967
    Mu3:
    SAHV_2047
    Mu50:
    SAV2062
    MW2:
    MW1986
    RF122:
    SAB1947c
    ST398:
    SAPIG2103
    T0131:
    SAT0131_02219 (mnhD)
    TCH60:
    HMPREF0772_11133
    TW20:
    SATW20_22020
    USA300_TCH1516:
    USA300HOU_2057
    VC40:
    SAVC_09190

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNNDKLQRMVENLSEEKFGRTFRHCAYFNKRLRTTGGRYLLKSHDIEINPKQYEHYGEDA
    N315            MNNDKLQRMVENLSEEKFGRTFRHCAYFNKRLRTTGGRYLLKSHDIEINPKQYEHYGEDA
    NCTC8325        MNNDKLQRMVENLSEEKFGRTFRHCAYFNKRLRTTGGRYLLKSHDIEINPKQYEHYGEDA
    Newman          MNNDKLQRMVENLSEEKFGRTFRHCAYFNKRLRTTGGRYLLKSHDIEINPKQYEHYGEDA
    USA300_FPR3757  MNNDKLQRMVENLSEEKFGRTFRHCAYFNKRLRTTGGRYLLKSHDIEINPKQYEHYGEDA
                    ************************************************************

    COL             VVKIILHELCHYHLHIAGKGYQHKDQDFKRLSQQVGAPRFCNSIESYQQRANYEYYCTKC
    N315            VVKIILHELCHYHLHIAGKGYQHKDQDFKRLSQQVGAPRFCNSIESYQQRANYEYYCTKC
    NCTC8325        VVKIILHELCHYHLHIAGKGYQHKDQDFKRLSQQVGAPRFCNSIESYQQRANYEYYCTKC
    Newman          VVKIILHELCHYHLHIAGKGYQHKDQDFKRLSQQVGAPRFCNSIESYQQRANYEYYCTKC
    USA300_FPR3757  VVKIILHELCHYHLHIAGKGYQHKDQDFKRLSQQVGAPRFCNSIESYQQRANYEYYCTKC
                    ************************************************************

    COL             HAKYIRIRKVDTNRMRCGHCNGKLRMKRQLK
    N315            HAKYIRIRKVDTNRMRCGHCNGKLRMKRQLK
    NCTC8325        HAKYIRIRKVDTNRMRCGHCNGKLRMKRQLK
    Newman          HAKYIRIRKVDTNRMRCGHCNGKLRMKRQLK
    USA300_FPR3757  HAKYIRIRKVDTNRMRCGHCNGKLRMKRQLK
                    *******************************